Clone SD13446 Report

Search the DGRC for SD13446

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:134
Well:46
Vector:pOT2
Associated Gene/TranscriptCG4210-RB
Protein status:SD13446.pep: full length peptide match
Sequenced Size:733

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4210 2002-10-31 Blastp of sequenced clone
CG4210 2003-01-01 Sim4 clustering to Release 3
CG4210 2008-04-29 Release 5.5 accounting
CG4210 2008-08-15 Release 5.9 accounting
CG4210 2008-12-18 5.12 accounting

Clone Sequence Records

SD13446.complete Sequence

733 bp (733 high quality bases) assembled on 2002-10-31

GenBank Submission: BT001882

> SD13446.complete
AAAAACACAGGTTATAAAGATTTCCCACTATGTCGAAATCCGGAGAGTTT
ACATTCCGGCGTGCTCTAGCTGAAGATATTAAAGATGTGCTCTCCATGAT
TCAAGTTGAGTTTTATAAGATTCCTATTTTAATACCAATTTGAGATACTT
TTGAATTGATCTGCAGGAACTGGCTGACTTTGAGAAGATGAGCAATGGTC
CCCAGCTAACAGAGGAAGATCTTAAACGAGACGCAGGACTCACTGGTGGC
CAGGAGTATTGTGAAGTCTATGTGCTTGTAGACAACGATACTGATCAGGC
GATTGGGTACTCCATTTGCTACAAGGCATACTCAACGTGGCAGGGACGGT
ACTTCTTCGTCGAGGACATCTATGTCCGCCCCGAGCACCGTAAACGCGGC
GCCGGAAAGCGAATCTTCTTGGAGGTTGCATCGCGGGCTGTAGAGCTTCA
GTGCCCTCGCCTGGAGTTTAATGTACTGGAATGGAATCCTGCACGCAAGT
TCTACGAAAGTCTTGGTGCCGTGGATTTGACAGATAAAGAGGGCTGGCAC
TACTACCGCGTGGAGGAGCAACAACTGGCCAAATTGGCCGCGGATCTGAG
GGCAAAAAAATCTTAACTTGATTTGATTTTCAATTTTTACTACTTTATAG
TAGGGCGATAAATAATTAATAATACTTGGCCATGGGCCATATGTGCTATG
AGTACATTGCAATTAAAAAAAAAAAAAAAAAAA

SD13446.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:53:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG4210-RB 802 CG4210-RB 33..748 1..716 3580 100 Plus
CG4210-RA 778 CG4210-RA 175..724 167..716 2750 100 Plus
CG4210-RA 778 CG4210-RA 71..175 1..105 525 100 Plus
CG6623-RA 3655 CG6623-RA 3557..3655 716..618 495 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:46:10
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 11039056..11039475 295..714 2100 100 Plus
chr3R 27901430 chr3R 11038634..11038851 1..218 1090 100 Plus
chr3R 27901430 chr3R 11038918..11038995 217..294 390 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:55:16 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:46:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15214426..15214847 295..716 2110 100 Plus
3R 32079331 3R 15214004..15214221 1..218 1090 100 Plus
3R 32079331 3R 15214288..15214365 217..294 390 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:12:41
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 14955257..14955678 295..716 2110 100 Plus
3R 31820162 3R 14954835..14955052 1..218 1090 100 Plus
3R 31820162 3R 14955119..14955196 217..294 390 100 Plus
Blast to na_te.dros performed on 2019-03-16 05:46:09 has no hits.

SD13446.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:46:47 Download gff for SD13446.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 11038634..11038851 1..218 100 -> Plus
chr3R 11038920..11038995 219..294 100 -> Plus
chr3R 11039056..11039475 295..714 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:07:41 Download gff for SD13446.complete
Subject Subject Range Query Range Percent Splice Strand
CG4210-RA 1..67 30..96 100 == Plus
CG4210-RA 68..525 157..616 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:50:08 Download gff for SD13446.complete
Subject Subject Range Query Range Percent Splice Strand
CG4210-RA 1..67 30..96 100 == Plus
CG4210-RA 68..525 157..616 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:12:54 Download gff for SD13446.complete
Subject Subject Range Query Range Percent Splice Strand
CG4210-RA 1..67 30..96 100 == Plus
CG4210-RA 68..525 157..616 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:32:16 Download gff for SD13446.complete
Subject Subject Range Query Range Percent Splice Strand
CG4210-RA 1..67 30..96 100 == Plus
CG4210-RA 68..525 157..616 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:10:21 Download gff for SD13446.complete
Subject Subject Range Query Range Percent Splice Strand
CG4210-RA 68..525 157..616 99   Plus
CG4210-RA 1..67 30..96 100 == Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:00:52 Download gff for SD13446.complete
Subject Subject Range Query Range Percent Splice Strand
CG4210-RB 31..708 1..678 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:50:08 Download gff for SD13446.complete
Subject Subject Range Query Range Percent Splice Strand
CG4210-RB 31..708 1..678 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:12:54 Download gff for SD13446.complete
Subject Subject Range Query Range Percent Splice Strand
CG4210-RA 31..126 1..96 100 == Plus
CG4210-RA 127..682 157..714 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:32:16 Download gff for SD13446.complete
Subject Subject Range Query Range Percent Splice Strand
CG4210-RB 31..708 1..678 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:10:21 Download gff for SD13446.complete
Subject Subject Range Query Range Percent Splice Strand
CG4210-RA 31..126 1..96 100 == Plus
CG4210-RA 127..682 157..714 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:46:47 Download gff for SD13446.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15214004..15214221 1..218 100 -> Plus
3R 15214290..15214365 219..294 100 -> Plus
3R 15214426..15214845 295..714 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:46:47 Download gff for SD13446.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15214004..15214221 1..218 100 -> Plus
3R 15214290..15214365 219..294 100 -> Plus
3R 15214426..15214845 295..714 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:46:47 Download gff for SD13446.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15214004..15214221 1..218 100 -> Plus
3R 15214290..15214365 219..294 100 -> Plus
3R 15214426..15214845 295..714 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:12:54 Download gff for SD13446.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11039726..11039943 1..218 100 -> Plus
arm_3R 11040012..11040087 219..294 100 -> Plus
arm_3R 11040148..11040567 295..714 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:12:14 Download gff for SD13446.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14954835..14955052 1..218 100 -> Plus
3R 14955121..14955196 219..294 100 -> Plus
3R 14955257..14955676 295..714 100   Plus

SD13446.pep Sequence

Translation from 187 to 615

> SD13446.pep
MSNGPQLTEEDLKRDAGLTGGQEYCEVYVLVDNDTDQAIGYSICYKAYST
WQGRYFFVEDIYVRPEHRKRGAGKRIFLEVASRAVELQCPRLEFNVLEWN
PARKFYESLGAVDLTDKEGWHYYRVEEQQLAKLAADLRAKKS*

SD13446.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:55:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11334-PA 174 GF11334-PA 33..174 1..142 672 88 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:55:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16894-PA 174 GG16894-PA 33..173 1..141 714 92.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:55:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18843-PA 171 GH18843-PA 33..169 1..137 510 67.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG4210-PA 174 CG4210-PA 33..174 1..142 757 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:55:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10105-PA 171 GI10105-PA 33..171 1..139 491 62.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:55:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12409-PA 170 GL12409-PA 33..169 1..137 660 87.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:55:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27656-PA 174 GA27656-PA 33..174 1..142 670 85.9 Plus
Dpse\GA18034-PA 174 GA18034-PA 33..174 1..142 670 85.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:55:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24203-PA 174 GM24203-PA 33..174 1..142 751 97.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:55:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18993-PA 174 GD18993-PA 33..174 1..142 730 95.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:55:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23842-PA 171 GJ23842-PA 33..169 1..137 524 67.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:55:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11862-PA 166 GK11862-PA 28..162 1..134 478 65.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:55:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24276-PA 174 GE24276-PA 33..174 1..142 720 93 Plus

SD13446.hyp Sequence

Translation from 187 to 615

> SD13446.hyp
MSNGPQLTEEDLKRDAGLTGGQEYCEVYVLVDNDTDQAIGYSICYKAYST
WQGRYFFVEDIYVRPEHRKRGAGKRIFLEVASRAVELQCPRLEFNVLEWN
PARKFYESLGAVDLTDKEGWHYYRVEEQQLAKLAADLRAKKS*

SD13446.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:23:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG4210-PA 174 CG4210-PA 33..174 1..142 757 100 Plus