BDGP Sequence Production Resources |
Search the DGRC for SD13446
Library: | SD |
Tissue Source: | Drosophila melanogaster Schneider L2 cell culture |
Created by: | Ling Hong |
Date Registered: | 1999-02-25 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 134 |
Well: | 46 |
Vector: | pOT2 |
Associated Gene/Transcript | CG4210-RB |
Protein status: | SD13446.pep: full length peptide match |
Sequenced Size: | 733 |
Gene | Date | Evidence |
---|---|---|
CG4210 | 2002-10-31 | Blastp of sequenced clone |
CG4210 | 2003-01-01 | Sim4 clustering to Release 3 |
CG4210 | 2008-04-29 | Release 5.5 accounting |
CG4210 | 2008-08-15 | Release 5.9 accounting |
CG4210 | 2008-12-18 | 5.12 accounting |
733 bp (733 high quality bases) assembled on 2002-10-31
GenBank Submission: BT001882
> SD13446.complete AAAAACACAGGTTATAAAGATTTCCCACTATGTCGAAATCCGGAGAGTTT ACATTCCGGCGTGCTCTAGCTGAAGATATTAAAGATGTGCTCTCCATGAT TCAAGTTGAGTTTTATAAGATTCCTATTTTAATACCAATTTGAGATACTT TTGAATTGATCTGCAGGAACTGGCTGACTTTGAGAAGATGAGCAATGGTC CCCAGCTAACAGAGGAAGATCTTAAACGAGACGCAGGACTCACTGGTGGC CAGGAGTATTGTGAAGTCTATGTGCTTGTAGACAACGATACTGATCAGGC GATTGGGTACTCCATTTGCTACAAGGCATACTCAACGTGGCAGGGACGGT ACTTCTTCGTCGAGGACATCTATGTCCGCCCCGAGCACCGTAAACGCGGC GCCGGAAAGCGAATCTTCTTGGAGGTTGCATCGCGGGCTGTAGAGCTTCA GTGCCCTCGCCTGGAGTTTAATGTACTGGAATGGAATCCTGCACGCAAGT TCTACGAAAGTCTTGGTGCCGTGGATTTGACAGATAAAGAGGGCTGGCAC TACTACCGCGTGGAGGAGCAACAACTGGCCAAATTGGCCGCGGATCTGAG GGCAAAAAAATCTTAACTTGATTTGATTTTCAATTTTTACTACTTTATAG TAGGGCGATAAATAATTAATAATACTTGGCCATGGGCCATATGTGCTATG AGTACATTGCAATTAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG4210-RB | 802 | CG4210-RB | 33..748 | 1..716 | 3580 | 100 | Plus |
CG4210-RA | 778 | CG4210-RA | 175..724 | 167..716 | 2750 | 100 | Plus |
CG4210-RA | 778 | CG4210-RA | 71..175 | 1..105 | 525 | 100 | Plus |
CG6623-RA | 3655 | CG6623-RA | 3557..3655 | 716..618 | 495 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 11039056..11039475 | 295..714 | 2100 | 100 | Plus |
chr3R | 27901430 | chr3R | 11038634..11038851 | 1..218 | 1090 | 100 | Plus |
chr3R | 27901430 | chr3R | 11038918..11038995 | 217..294 | 390 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 15214426..15214847 | 295..716 | 2110 | 100 | Plus |
3R | 32079331 | 3R | 15214004..15214221 | 1..218 | 1090 | 100 | Plus |
3R | 32079331 | 3R | 15214288..15214365 | 217..294 | 390 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 14955257..14955678 | 295..716 | 2110 | 100 | Plus |
3R | 31820162 | 3R | 14954835..14955052 | 1..218 | 1090 | 100 | Plus |
3R | 31820162 | 3R | 14955119..14955196 | 217..294 | 390 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 11038634..11038851 | 1..218 | 100 | -> | Plus |
chr3R | 11038920..11038995 | 219..294 | 100 | -> | Plus |
chr3R | 11039056..11039475 | 295..714 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4210-RA | 1..67 | 30..96 | 100 | == | Plus |
CG4210-RA | 68..525 | 157..616 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4210-RA | 1..67 | 30..96 | 100 | == | Plus |
CG4210-RA | 68..525 | 157..616 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4210-RA | 1..67 | 30..96 | 100 | == | Plus |
CG4210-RA | 68..525 | 157..616 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4210-RA | 1..67 | 30..96 | 100 | == | Plus |
CG4210-RA | 68..525 | 157..616 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4210-RA | 68..525 | 157..616 | 99 | Plus | |
CG4210-RA | 1..67 | 30..96 | 100 | == | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4210-RB | 31..708 | 1..678 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4210-RB | 31..708 | 1..678 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4210-RA | 31..126 | 1..96 | 100 | == | Plus |
CG4210-RA | 127..682 | 157..714 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4210-RB | 31..708 | 1..678 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4210-RA | 31..126 | 1..96 | 100 | == | Plus |
CG4210-RA | 127..682 | 157..714 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 15214004..15214221 | 1..218 | 100 | -> | Plus |
3R | 15214290..15214365 | 219..294 | 100 | -> | Plus |
3R | 15214426..15214845 | 295..714 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 15214004..15214221 | 1..218 | 100 | -> | Plus |
3R | 15214290..15214365 | 219..294 | 100 | -> | Plus |
3R | 15214426..15214845 | 295..714 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 15214004..15214221 | 1..218 | 100 | -> | Plus |
3R | 15214290..15214365 | 219..294 | 100 | -> | Plus |
3R | 15214426..15214845 | 295..714 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 11039726..11039943 | 1..218 | 100 | -> | Plus |
arm_3R | 11040012..11040087 | 219..294 | 100 | -> | Plus |
arm_3R | 11040148..11040567 | 295..714 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 14954835..14955052 | 1..218 | 100 | -> | Plus |
3R | 14955121..14955196 | 219..294 | 100 | -> | Plus |
3R | 14955257..14955676 | 295..714 | 100 | Plus |
Translation from 187 to 615
> SD13446.pep MSNGPQLTEEDLKRDAGLTGGQEYCEVYVLVDNDTDQAIGYSICYKAYST WQGRYFFVEDIYVRPEHRKRGAGKRIFLEVASRAVELQCPRLEFNVLEWN PARKFYESLGAVDLTDKEGWHYYRVEEQQLAKLAADLRAKKS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF11334-PA | 174 | GF11334-PA | 33..174 | 1..142 | 672 | 88 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG16894-PA | 174 | GG16894-PA | 33..173 | 1..141 | 714 | 92.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18843-PA | 171 | GH18843-PA | 33..169 | 1..137 | 510 | 67.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG4210-PA | 174 | CG4210-PA | 33..174 | 1..142 | 757 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI10105-PA | 171 | GI10105-PA | 33..171 | 1..139 | 491 | 62.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL12409-PA | 170 | GL12409-PA | 33..169 | 1..137 | 660 | 87.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA27656-PA | 174 | GA27656-PA | 33..174 | 1..142 | 670 | 85.9 | Plus |
Dpse\GA18034-PA | 174 | GA18034-PA | 33..174 | 1..142 | 670 | 85.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM24203-PA | 174 | GM24203-PA | 33..174 | 1..142 | 751 | 97.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD18993-PA | 174 | GD18993-PA | 33..174 | 1..142 | 730 | 95.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23842-PA | 171 | GJ23842-PA | 33..169 | 1..137 | 524 | 67.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK11862-PA | 166 | GK11862-PA | 28..162 | 1..134 | 478 | 65.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE24276-PA | 174 | GE24276-PA | 33..174 | 1..142 | 720 | 93 | Plus |
Translation from 187 to 615
> SD13446.hyp MSNGPQLTEEDLKRDAGLTGGQEYCEVYVLVDNDTDQAIGYSICYKAYST WQGRYFFVEDIYVRPEHRKRGAGKRIFLEVASRAVELQCPRLEFNVLEWN PARKFYESLGAVDLTDKEGWHYYRVEEQQLAKLAADLRAKKS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG4210-PA | 174 | CG4210-PA | 33..174 | 1..142 | 757 | 100 | Plus |