Clone SD13613 Report

Search the DGRC for SD13613

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:136
Well:13
Vector:pOT2
Associated Gene/TranscriptRlb1-RA
Protein status:SD13613.pep: gold
Preliminary Size:2266
Sequenced Size:1435

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8161 2002-01-01 Sim4 clustering to Release 2
CG8161 2002-05-18 Blastp of sequenced clone
CG8161 2003-01-01 Sim4 clustering to Release 3
Rlb1 2008-04-29 Release 5.5 accounting
Rlb1 2008-08-15 Release 5.9 accounting
Rlb1 2008-12-18 5.12 accounting

Clone Sequence Records

SD13613.complete Sequence

1435 bp (1435 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119200

> SD13613.complete
AAAACAGCATGGACAGATTGAAATTCAATAATTTGGTGATATCCAACAAG
AAGGTCATTCAAAAGGCACGCGCCCAGACCATCGCCAAAATCGTACAAAA
GCTGCGAAAGACAAAAGAGGCTCTGGCCAAAAATCCAGACAGTGAAAAGG
AAAAGATTCGTTTACGCAAGAACACAGAATGCCTGGCCCAGTTGAAGGCT
CTAAAATATATGGATATGGTACGCCAGTCGCTCCTGCAGGAGGGCACAAA
TCCCAATGCGGTGATTGCTAACGAGCGCTCCACGCCGGATGAACTGGGCA
TTGCCATGCTGCGGCTAAACAAATTGATGCACGGACTGGTGGACAAGTTT
GTGGAAACCTTGAAGCTGAGCACCACCGATAAGGAGGCCAAGTGGCGTGA
GGAGATCCTAGAGACGAGCAAGCGAAGGGCCAAAATAGAACGCACTGAGG
AGCGGAAGAGGAAGCGCAAGGAGCTGAAGGAGCAGAAGGCCCAAACCAAA
AACCGACTGGAGTGGTTAGAGCAGAACAAAGTGGTGGATGCAGATGTTAA
TGGAGCAACTGCGGAAACGCCCACTCTTCAAGTCAGCAAAGTAAATGATC
AGGAAATACCACAGTCTTTTGCAAAAACTGAAAATTCTCCAGTTCTCAAA
GTCAAAAAGGAAAAGACACCTAAAACACCAGCCAAAAAAGAAAGAAACCT
TCAGAAAAAACAAGCTTTTGATGAGCAGATCAACCCGGAGATAACTAAGC
TCAGTTCCAAAAAGCAGAATTTAAATACAATCAAGGAGAATAATGCAGAG
CCACAACTAGAAGGCAGACCGAAAGAATCTAAGCCAAAACCCTTCGAGAA
AAAACCAGCCAGAGAGCAGAAGCCTAAGCCACGATTAGAAAGGCAGCCAA
GTATCGATGAAGAAGAACCACAACTTGACAATAATCGTCCCACACATGTC
GTTGATCCCTTCTTCATTACGGAATCAGGCCAGCCCTACTTGTCCAGCGC
CGTGGTTCTTTCCGGGGACAATGACAGCGAAGCTGATGAGGAACAGGCAC
CGCCGCCAGTCAAAAGGTTCCGCAATGAGGATCGACGGTCGAACACATAT
CGGGAGAAACCGGAAAGACAGCCAGAGTTCAAAGCGAGAAAGCCAACTGA
TGATCGTCATCCCTCCTGGCTGGCTAAGCAACAGCAGAAACCAATCATTG
GTGATTTTAGAGGCAAGAAGATTACATTCGGCGACGACGGCCAGGCGGCG
GAAATTATTGCTCCAAGTATCAATCAATTAACCGCTACTGCTGCTCCTTT
GCCCACCGATGGCATGCACCCGTCTTGGGTGGCCAAACAGAAGTTTAAGC
CGAAAATTGCCGCGTTTCAGGGCACAAAGATTAAGTTTGACGAAGATTAA
AGATGATGTCAATGGTAAAAAAAAAAAAAAAAAAA

SD13613.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:00:46
Subject Length Description Subject Range Query Range Score Percent Strand
Rlb1-RA 1544 Rlb1-RA 128..1544 1..1417 7085 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:40:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 5339274..5340655 35..1416 6865 99.8 Plus
chr3R 27901430 chr3R 5339183..5339219 1..37 185 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:55:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:40:46
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9513446..9514828 35..1417 6915 100 Plus
3R 32079331 3R 9513355..9513391 1..37 185 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:32:39
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9254277..9255659 35..1417 6915 100 Plus
3R 31820162 3R 9254186..9254222 1..37 185 100 Plus
Blast to na_te.dros performed 2019-03-15 14:40:47
Subject Length Description Subject Range Query Range Score Percent Strand
diver 6112 diver Tinker 6112bp 4262..4389 267..143 135 62.3 Minus

SD13613.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:41:40 Download gff for SD13613.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 5339183..5339217 1..35 100 -> Plus
chr3R 5339275..5340655 36..1416 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:07:42 Download gff for SD13613.complete
Subject Subject Range Query Range Percent Splice Strand
Rlb1-RA 1..1392 9..1400 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:41:05 Download gff for SD13613.complete
Subject Subject Range Query Range Percent Splice Strand
Rlb1-RA 1..1392 9..1400 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:39:14 Download gff for SD13613.complete
Subject Subject Range Query Range Percent Splice Strand
Rlb1-RA 1..1392 9..1400 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:33:03 Download gff for SD13613.complete
Subject Subject Range Query Range Percent Splice Strand
Rlb1-RA 1..1392 9..1400 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:06:22 Download gff for SD13613.complete
Subject Subject Range Query Range Percent Splice Strand
Rlb1-RA 1..1392 9..1400 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:14:58 Download gff for SD13613.complete
Subject Subject Range Query Range Percent Splice Strand
Rlb1-RA 10..1425 1..1416 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:41:05 Download gff for SD13613.complete
Subject Subject Range Query Range Percent Splice Strand
Rlb1-RA 17..1432 1..1416 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:39:14 Download gff for SD13613.complete
Subject Subject Range Query Range Percent Splice Strand
Rlb1-RA 29..1444 1..1416 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:33:03 Download gff for SD13613.complete
Subject Subject Range Query Range Percent Splice Strand
Rlb1-RA 10..1425 1..1416 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:06:22 Download gff for SD13613.complete
Subject Subject Range Query Range Percent Splice Strand
Rlb1-RA 29..1444 1..1416 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:41:40 Download gff for SD13613.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9513355..9513389 1..35 100 -> Plus
3R 9513447..9514827 36..1416 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:41:40 Download gff for SD13613.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9513355..9513389 1..35 100 -> Plus
3R 9513447..9514827 36..1416 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:41:40 Download gff for SD13613.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9513355..9513389 1..35 100 -> Plus
3R 9513447..9514827 36..1416 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:39:14 Download gff for SD13613.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5339077..5339111 1..35 100 -> Plus
arm_3R 5339169..5340549 36..1416 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:05:29 Download gff for SD13613.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9254278..9255658 36..1416 100   Plus
3R 9254186..9254220 1..35 100 -> Plus

SD13613.hyp Sequence

Translation from 2 to 1399

> SD13613.hyp
NSMDRLKFNNLVISNKKVIQKARAQTIAKIVQKLRKTKEALAKNPDSEKE
KIRLRKNTECLAQLKALKYMDMVRQSLLQEGTNPNAVIANERSTPDELGI
AMLRLNKLMHGLVDKFVETLKLSTTDKEAKWREEILETSKRRAKIERTEE
RKRKRKELKEQKAQTKNRLEWLEQNKVVDADVNGATAETPTLQVSKVNDQ
EIPQSFAKTENSPVLKVKKEKTPKTPAKKERNLQKKQAFDEQINPEITKL
SSKKQNLNTIKENNAEPQLEGRPKESKPKPFEKKPAREQKPKPRLERQPS
IDEEEPQLDNNRPTHVVDPFFITESGQPYLSSAVVLSGDNDSEADEEQAP
PPVKRFRNEDRRSNTYREKPERQPEFKARKPTDDRHPSWLAKQQQKPIIG
DFRGKKITFGDDGQAAEIIAPSINQLTATAAPLPTDGMHPSWVAKQKFKP
KIAAFQGTKIKFDED*

SD13613.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:54:48
Subject Length Description Subject Range Query Range Score Percent Strand
Rlb1-PA 463 CG8161-PA 1..463 3..465 2373 100 Plus
rudhira-PE 2075 CG43154-PE 1341..1627 25..308 163 26.1 Plus
rudhira-PC 2075 CG43154-PC 1341..1627 25..308 163 26.1 Plus

SD13613.pep Sequence

Translation from 8 to 1399

> SD13613.pep
MDRLKFNNLVISNKKVIQKARAQTIAKIVQKLRKTKEALAKNPDSEKEKI
RLRKNTECLAQLKALKYMDMVRQSLLQEGTNPNAVIANERSTPDELGIAM
LRLNKLMHGLVDKFVETLKLSTTDKEAKWREEILETSKRRAKIERTEERK
RKRKELKEQKAQTKNRLEWLEQNKVVDADVNGATAETPTLQVSKVNDQEI
PQSFAKTENSPVLKVKKEKTPKTPAKKERNLQKKQAFDEQINPEITKLSS
KKQNLNTIKENNAEPQLEGRPKESKPKPFEKKPAREQKPKPRLERQPSID
EEEPQLDNNRPTHVVDPFFITESGQPYLSSAVVLSGDNDSEADEEQAPPP
VKRFRNEDRRSNTYREKPERQPEFKARKPTDDRHPSWLAKQQQKPIIGDF
RGKKITFGDDGQAAEIIAPSINQLTATAAPLPTDGMHPSWVAKQKFKPKI
AAFQGTKIKFDED*

SD13613.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:26:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18935-PA 416 GF18935-PA 2..416 1..462 1250 62.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:26:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16831-PA 461 GG16831-PA 1..461 1..463 1935 86.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 04:26:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18201-PA 449 GH18201-PA 2..449 1..463 895 48 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:22:41
Subject Length Description Subject Range Query Range Score Percent Strand
Rlb1-PA 463 CG8161-PA 1..463 1..463 2373 100 Plus
rudhira-PE 2075 CG43154-PE 1341..1627 23..306 163 26.1 Plus
rudhira-PC 2075 CG43154-PC 1341..1627 23..306 163 26.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 04:26:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10154-PA 479 GI10154-PA 2..479 1..462 851 41.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:26:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21612-PA 452 GL21612-PA 2..452 1..463 1210 56.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:26:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20858-PA 452 GA20858-PA 2..452 1..463 1205 55.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:26:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23810-PA 468 GM23810-PA 1..468 1..463 2268 93.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:26:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Rlb1-PA 468 GD18618-PA 1..468 1..463 2229 93.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:26:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10856-PA 516 GJ10856-PA 2..516 1..462 889 44.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:26:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13837-PA 418 GK13837-PA 2..418 1..409 530 39.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:26:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25956-PA 471 GE25956-PA 1..471 1..463 1972 85.2 Plus