Clone SD14047 Report

Search the DGRC for SD14047

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:140
Well:47
Vector:pOT2
Associated Gene/TranscriptRFeSP-RB
Protein status:SD14047.pep: gold
Sequenced Size:848

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
RFeSP-RB 2010-02-16 Manual selection by Sue Celniker

Clone Sequence Records

SD14047.complete Sequence

848 bp assembled on 2010-03-02

GenBank Submission: BT122041.1

> SD14047.complete
CAGACGAAAACGACAAACGTCGAAATTTTCGTGATCATTTAATTTGATAG
GAAAACATACAAAATGATGAACGCCGTGTCGCGTGCTTACGTCAGAGGCG
GAGCCCAGGTCCTCTCCACGGGATTGAAGGCGAGCGGCGTGGCCGTCAAC
TCGATGGCCAATCGCCAGGCACACACCGACCTGCAGGTGCCAGACTTCTC
GGCATACCGCCGGGAGTCCGTGAAGGACAGTCGTCGTCGCAACGACACCG
CCGAGGAGCGCAAGGCCTTCTCCTACTTGATGGTCGGCGCCGGAGCCGTG
GGCGGTGCCTATGCGGCCAAGGGCCTGGTTAACACCTTCATCGGATCGAT
GAGCGCCTCCGCCGAAGTGCTGGCCATGGCCAAGATCGAGATCAAGCTGT
CCGACATCCCGGAGGGCAAGTCGGTTACTTTCAAGTGGCGCGGAAAGCCC
CTGTTCATCCGCCACCGCACGGCCGCGGAAATCGAGACCGAGCGAAATGT
GCCCACATCCACGCTGCGCGATCCGGAGGCTGATGATCAACGTGTGATCA
AGCCCGAGTGGCTGGTGGTCATCGGAGTGTGCACGCATCTGGGCTGTGTG
CCCATCGCGAACGCCGGCGACTGGGGTGGCTACTACTGCCCCTGCCACGG
CTCCCACTACGACGCCTCCGGAAGGATCCGCAAGGGACCCGCGCCCCTCA
ACTTGGAGGTGCCCACCCACGAGTTCCCCAACGAGGGTCTTCTCGTGGTC
GGCTAGAGGAGCTGTTATCGTTTAAGCCCCCAACTGCATAGTGAATGGAT
CGATGTAAATTAATAAATACAACCAAACAGAAAAAAAAAAAAAAAAAA

SD14047.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:36:26
Subject Length Description Subject Range Query Range Score Percent Strand
RFeSP-RB 1088 RFeSP-RB 58..889 1..832 4145 99.8 Plus
RFeSP.a 1092 RFeSP.a 58..893 1..832 4080 99.4 Plus
RFeSP-RA 1143 RFeSP-RA 58..594 1..537 2670 99.8 Plus
RFeSP-RA 1143 RFeSP-RA 650..944 538..832 1475 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:50:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 1612924..1613304 537..157 1845 99 Minus
chr2L 23010047 chr2L 1612576..1612868 830..538 1435 99.3 Minus
chr2L 23010047 chr2L 1613863..1614019 157..1 770 99.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:55:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:50:25
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1613044..1613424 537..157 1905 100 Minus
2L 23513712 2L 1612694..1612988 832..538 1475 100 Minus
2L 23513712 2L 1613983..1614139 157..1 770 99.4 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:53:06
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1613044..1613424 537..157 1905 100 Minus
2L 23513712 2L 1612694..1612988 832..538 1475 100 Minus
2L 23513712 2L 1613983..1614139 157..1 770 99.3 Minus
Blast to na_te.dros performed on 2019-03-16 07:50:25 has no hits.

SD14047.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:51:16 Download gff for SD14047.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 1612576..1612868 538..830 99 <- Minus
chr2L 1612924..1613303 158..537 98 <- Minus
chr2L 1613863..1614019 1..157 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-03-03 09:17:12 Download gff for SD14047.complete
Subject Subject Range Query Range Percent Splice Strand
RFeSP-RB 1..693 64..756 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:55:43 Download gff for SD14047.complete
Subject Subject Range Query Range Percent Splice Strand
RFeSP-RB 1..693 64..756 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:40:01 Download gff for SD14047.complete
Subject Subject Range Query Range Percent Splice Strand
RFeSP-RB 1..693 64..756 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:41:14 Download gff for SD14047.complete
Subject Subject Range Query Range Percent Splice Strand
RFeSP-RB 1..693 64..756 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-03-03 09:17:12 Download gff for SD14047.complete
Subject Subject Range Query Range Percent Splice Strand
RFeSP-RB 44..873 1..830 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:55:43 Download gff for SD14047.complete
Subject Subject Range Query Range Percent Splice Strand
RFeSP-RB 44..873 1..830 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:40:01 Download gff for SD14047.complete
Subject Subject Range Query Range Percent Splice Strand
RFeSP-RB 22..851 1..830 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:41:14 Download gff for SD14047.complete
Subject Subject Range Query Range Percent Splice Strand
RFeSP-RB 22..851 1..830 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:51:16 Download gff for SD14047.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1613983..1614139 1..157 99   Minus
2L 1612696..1612988 538..830 100 <- Minus
2L 1613044..1613423 158..537 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:51:16 Download gff for SD14047.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1613983..1614139 1..157 99   Minus
2L 1612696..1612988 538..830 100 <- Minus
2L 1613044..1613423 158..537 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:51:16 Download gff for SD14047.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1613983..1614139 1..157 99   Minus
2L 1612696..1612988 538..830 100 <- Minus
2L 1613044..1613423 158..537 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:40:01 Download gff for SD14047.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 1613983..1614139 1..157 99   Minus
arm_2L 1612696..1612988 538..830 100 <- Minus
arm_2L 1613044..1613423 158..537 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:32:16 Download gff for SD14047.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1612696..1612988 538..830 100 <- Minus
2L 1613044..1613423 158..537 100 <- Minus
2L 1613983..1614139 1..157 99   Minus

SD14047.pep Sequence

Translation from 63 to 755

> SD14047.pep
MMNAVSRAYVRGGAQVLSTGLKASGVAVNSMANRQAHTDLQVPDFSAYRR
ESVKDSRRRNDTAEERKAFSYLMVGAGAVGGAYAAKGLVNTFIGSMSASA
EVLAMAKIEIKLSDIPEGKSVTFKWRGKPLFIRHRTAAEIETERNVPTST
LRDPEADDQRVIKPEWLVVIGVCTHLGCVPIANAGDWGGYYCPCHGSHYD
ASGRIRKGPAPLNLEVPTHEFPNEGLLVVG*

SD14047.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:15:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14036-PA 230 GF14036-PA 1..230 1..230 1126 89.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:15:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24583-PA 230 GG24583-PA 1..230 1..230 1209 98.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 21:15:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10320-PA 230 GH10320-PA 1..230 1..230 1081 85.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:40:49
Subject Length Description Subject Range Query Range Score Percent Strand
RFeSP-PE 230 CG7361-PE 1..230 1..230 1199 100 Plus
RFeSP-PD 230 CG7361-PD 1..230 1..230 1199 100 Plus
RFeSP-PB 230 CG7361-PB 1..230 1..230 1199 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 21:15:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17080-PA 227 GI17080-PA 1..227 1..230 1052 84.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:15:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14741-PA 230 GL14741-PA 1..230 1..230 1034 87 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:15:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25273-PA 230 GA25273-PA 1..230 1..230 1037 87.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:15:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16602-PA 230 GM16602-PA 1..230 1..230 1225 99.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:15:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22901-PA 249 GD22901-PA 1..218 1..218 1163 99.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:15:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10683-PA 227 GJ10683-PA 1..227 1..230 1042 83.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:15:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14939-PA 221 GK14939-PA 1..221 1..230 1039 83.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:15:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\RFeSP-PA 230 GE15522-PA 1..230 1..230 1215 98.7 Plus

SD14047.hyp Sequence

Translation from 63 to 755

> SD14047.hyp
MMNAVSRAYVRGGAQVLSTGLKASGVAVNSMANRQAHTDLQVPDFSAYRR
ESVKDSRRRNDTAEERKAFSYLMVGAGAVGGAYAAKGLVNTFIGSMSASA
EVLAMAKIEIKLSDIPEGKSVTFKWRGKPLFIRHRTAAEIETERNVPTST
LRDPEADDQRVIKPEWLVVIGVCTHLGCVPIANAGDWGGYYCPCHGSHYD
ASGRIRKGPAPLNLEVPTHEFPNEGLLVVG*

SD14047.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:26:33
Subject Length Description Subject Range Query Range Score Percent Strand
RFeSP-PE 230 CG7361-PE 1..230 1..230 1199 100 Plus
RFeSP-PD 230 CG7361-PD 1..230 1..230 1199 100 Plus
RFeSP-PB 230 CG7361-PB 1..230 1..230 1199 100 Plus