Associations are from manual ordering of a clone or by a periodic analysis.
Clone Sequence Records
SD15155.complete Sequence
747 bp (747 high quality bases) assembled on 2006-07-27
GenBank Submission: BT028872
> SD15155.complete
CGGGTTTACACGATCCGAGAGCTTTGCATCGCAGAAACAGAAGAAGAAGA
AGGCATTGAAGTCCATATCCTATACCGAAGCTATCATGTTGAAGGCGATT
ATCGTTTTTGCCACTATCTTGGTGGCCGTGGCCATGGCCATGCAGCCACT
GGAGGACAATGAGCGAACCCATCATCTGAACCACAAGCGCCAGTTGTCGC
AACAGCACCACCACCACCACCAAAAGCTCCAGGAGGTGAGGCATTCGGGC
CATGATAGTCTGAAACATGGTGGTTCCCACGTTAAGGAGCATCAAGCGCA
TCACTCTGAGCGAAAGGCCAGGCAGAGCCACAAGGAGCCGGGCCACAAGA
AGAGTCACCACCAGAAGGAGCACCGCCAGCAGCAGGACAACCACACCCGC
AAATCCCGATCGCATTCCAAGGGCAGCAAGCAGCATCACAAGCGGCACAC
GGGATCGCGTCGCCACTAGGATAATCCTGTATCCTGTGGCCAGGATATAT
TCTATTTAAACTCTAGCCAATGGATTCCTTATGCGAGGATTAAACTCCGA
ATACAGTAAACACTCGTATAATTGCATGTATGGCAACAGTAAAGCCAATC
TATTTAAATGTTTACAAAACTACTGTGAAATATAAGCCATGACCAAATAA
ACACACATTTCATAAATGATATTAATATCCCCAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
SD15155.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 19:49:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34232.a | 1027 | CG34232.a | 300..983 | 1..684 | 3405 | 99.8 | Plus |
CG34232-RA | 813 | CG34232-RA | 86..769 | 1..684 | 3405 | 99.8 | Plus |
CG34232-RB | 636 | CG34232-RB | 209..636 | 97..524 | 2140 | 100 | Plus |
CG34232-RB | 636 | CG34232-RB | 1..80 | 18..97 | 400 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:10:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 8052126..8052709 | 680..97 | 2860 | 99.3 | Minus |
chr2R | 21145070 | chr2R | 8052838..8052934 | 97..1 | 485 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:55:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:10:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 12164907..12165494 | 684..97 | 2925 | 99.8 | Minus |
2R | 25286936 | 2R | 12165623..12165719 | 97..1 | 485 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:15:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 12166106..12166693 | 684..97 | 2925 | 99.8 | Minus |
2R | 25260384 | 2R | 12166822..12166918 | 97..1 | 485 | 100 | Minus |
Blast to na_te.dros performed 2019-03-15 23:10:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
rooA | 7621 | rooA ROOA_LTR 7621bp | 5006..5072 | 535..605 | 128 | 70.4 | Plus |
gypsy12 | 10218 | gypsy12 GYPSY12 10218bp | 696..737 | 364..405 | 111 | 73.8 | Plus |
gypsy12 | 10218 | gypsy12 GYPSY12 10218bp | 8578..8619 | 364..405 | 111 | 73.8 | Plus |
SD15155.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:11:39 Download gff for
SD15155.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 8052124..8052708 | 98..682 | 99 | <- | Minus |
chr2R | 8052838..8052934 | 1..97 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:08:17 Download gff for
SD15155.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34232-RA | 1..384 | 86..469 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:17:48 Download gff for
SD15155.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34232-RA | 1..384 | 86..469 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:30:31 Download gff for
SD15155.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34232-RA | 1..384 | 86..469 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:43:54 Download gff for
SD15155.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34232-RA | 1..384 | 86..469 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:22:01 Download gff for
SD15155.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34232-RA | 1..384 | 86..469 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:50:34 Download gff for
SD15155.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34232-RA | 1..680 | 1..680 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:17:48 Download gff for
SD15155.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34232-RA | 1..680 | 1..680 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:30:31 Download gff for
SD15155.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34232-RA | 1..682 | 1..682 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:43:54 Download gff for
SD15155.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34232-RA | 1..680 | 1..680 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:22:01 Download gff for
SD15155.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34232-RA | 21..702 | 1..682 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:11:39 Download gff for
SD15155.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 12165623..12165719 | 1..97 | 100 | | Minus |
2R | 12164909..12165493 | 98..682 | 99 | <- | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:11:39 Download gff for
SD15155.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 12165623..12165719 | 1..97 | 100 | | Minus |
2R | 12164909..12165493 | 98..682 | 99 | <- | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:11:39 Download gff for
SD15155.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 12165623..12165719 | 1..97 | 100 | | Minus |
2R | 12164909..12165493 | 98..682 | 99 | <- | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:30:31 Download gff for
SD15155.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 8052414..8052998 | 98..682 | 99 | <- | Minus |
arm_2R | 8053128..8053224 | 1..97 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:20:07 Download gff for
SD15155.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 12166822..12166918 | 1..97 | 100 | | Minus |
2R | 12166108..12166692 | 98..682 | 99 | <- | Minus |
SD15155.hyp Sequence
Translation from 0 to 468
> SD15155.hyp
GFTRSESFASQKQKKKKALKSISYTEAIMLKAIIVFATILVAVAMAMQPL
EDNERTHHLNHKRQLSQQHHHHHQKLQEVRHSGHDSLKHGGSHVKEHQAH
HSERKARQSHKEPGHKKSHHQKEHRQQQDNHTRKSRSHSKGSKQHHKRHT
GSRRH*
SD15155.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:22:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34232-PC | 127 | CG34232-PC | 1..127 | 29..155 | 696 | 100 | Plus |
CG34232-PA | 127 | CG34232-PA | 1..127 | 29..155 | 696 | 100 | Plus |
CG34232-PB | 129 | CG34232-PB | 7..129 | 33..155 | 678 | 100 | Plus |
SD15155.pep Sequence
Translation from 1 to 468
> SD15155.pep
GFTRSESFASQKQKKKKALKSISYTEAIMLKAIIVFATILVAVAMAMQPL
EDNERTHHLNHKRQLSQQHHHHHQKLQEVRHSGHDSLKHGGSHVKEHQAH
HSERKARQSHKEPGHKKSHHQKEHRQQQDNHTRKSRSHSKGSKQHHKRHT
GSRRH*
SD15155.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:06:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF12640-PA | 126 | GF12640-PA | 1..102 | 29..107 | 178 | 49.5 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:06:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG22603-PA | 122 | GG22603-PA | 1..122 | 29..155 | 414 | 71 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:15:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34232-PC | 127 | CG34232-PC | 1..127 | 29..155 | 696 | 100 | Plus |
CG34232-PA | 127 | CG34232-PA | 1..127 | 29..155 | 696 | 100 | Plus |
CG34232-PB | 129 | CG34232-PB | 7..129 | 33..155 | 678 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:06:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL11025-PA | 131 | GL11025-PA | 1..130 | 29..155 | 137 | 39 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:06:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM20382-PA | 127 | GM20382-PA | 1..127 | 29..155 | 495 | 92.1 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:06:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD25856-PA | 127 | GD25856-PA | 1..127 | 29..155 | 547 | 93.7 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:06:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE13471-PA | 133 | GE13471-PA | 1..133 | 29..155 | 493 | 78.8 | Plus |