Clone SD15155 Report

Search the DGRC for SD15155

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:151
Well:55
Vector:pOT2
Associated Gene/TranscriptCG34232-RA
Protein status:SD15155.pep: gold
Sequenced Size:747

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34232 2008-04-29 Release 5.5 accounting
CG34232 2008-08-15 Release 5.9 accounting
CG34232 2008-12-18 5.12 accounting

Clone Sequence Records

SD15155.complete Sequence

747 bp (747 high quality bases) assembled on 2006-07-27

GenBank Submission: BT028872

> SD15155.complete
CGGGTTTACACGATCCGAGAGCTTTGCATCGCAGAAACAGAAGAAGAAGA
AGGCATTGAAGTCCATATCCTATACCGAAGCTATCATGTTGAAGGCGATT
ATCGTTTTTGCCACTATCTTGGTGGCCGTGGCCATGGCCATGCAGCCACT
GGAGGACAATGAGCGAACCCATCATCTGAACCACAAGCGCCAGTTGTCGC
AACAGCACCACCACCACCACCAAAAGCTCCAGGAGGTGAGGCATTCGGGC
CATGATAGTCTGAAACATGGTGGTTCCCACGTTAAGGAGCATCAAGCGCA
TCACTCTGAGCGAAAGGCCAGGCAGAGCCACAAGGAGCCGGGCCACAAGA
AGAGTCACCACCAGAAGGAGCACCGCCAGCAGCAGGACAACCACACCCGC
AAATCCCGATCGCATTCCAAGGGCAGCAAGCAGCATCACAAGCGGCACAC
GGGATCGCGTCGCCACTAGGATAATCCTGTATCCTGTGGCCAGGATATAT
TCTATTTAAACTCTAGCCAATGGATTCCTTATGCGAGGATTAAACTCCGA
ATACAGTAAACACTCGTATAATTGCATGTATGGCAACAGTAAAGCCAATC
TATTTAAATGTTTACAAAACTACTGTGAAATATAAGCCATGACCAAATAA
ACACACATTTCATAAATGATATTAATATCCCCAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

SD15155.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:49:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG34232.a 1027 CG34232.a 300..983 1..684 3405 99.8 Plus
CG34232-RA 813 CG34232-RA 86..769 1..684 3405 99.8 Plus
CG34232-RB 636 CG34232-RB 209..636 97..524 2140 100 Plus
CG34232-RB 636 CG34232-RB 1..80 18..97 400 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:10:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8052126..8052709 680..97 2860 99.3 Minus
chr2R 21145070 chr2R 8052838..8052934 97..1 485 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:55:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:10:45
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12164907..12165494 684..97 2925 99.8 Minus
2R 25286936 2R 12165623..12165719 97..1 485 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:15:14
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12166106..12166693 684..97 2925 99.8 Minus
2R 25260384 2R 12166822..12166918 97..1 485 100 Minus
Blast to na_te.dros performed 2019-03-15 23:10:45
Subject Length Description Subject Range Query Range Score Percent Strand
rooA 7621 rooA ROOA_LTR 7621bp 5006..5072 535..605 128 70.4 Plus
gypsy12 10218 gypsy12 GYPSY12 10218bp 696..737 364..405 111 73.8 Plus
gypsy12 10218 gypsy12 GYPSY12 10218bp 8578..8619 364..405 111 73.8 Plus

SD15155.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:11:39 Download gff for SD15155.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8052124..8052708 98..682 99 <- Minus
chr2R 8052838..8052934 1..97 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:08:17 Download gff for SD15155.complete
Subject Subject Range Query Range Percent Splice Strand
CG34232-RA 1..384 86..469 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:17:48 Download gff for SD15155.complete
Subject Subject Range Query Range Percent Splice Strand
CG34232-RA 1..384 86..469 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:30:31 Download gff for SD15155.complete
Subject Subject Range Query Range Percent Splice Strand
CG34232-RA 1..384 86..469 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:43:54 Download gff for SD15155.complete
Subject Subject Range Query Range Percent Splice Strand
CG34232-RA 1..384 86..469 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:22:01 Download gff for SD15155.complete
Subject Subject Range Query Range Percent Splice Strand
CG34232-RA 1..384 86..469 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:50:34 Download gff for SD15155.complete
Subject Subject Range Query Range Percent Splice Strand
CG34232-RA 1..680 1..680 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:17:48 Download gff for SD15155.complete
Subject Subject Range Query Range Percent Splice Strand
CG34232-RA 1..680 1..680 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:30:31 Download gff for SD15155.complete
Subject Subject Range Query Range Percent Splice Strand
CG34232-RA 1..682 1..682 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:43:54 Download gff for SD15155.complete
Subject Subject Range Query Range Percent Splice Strand
CG34232-RA 1..680 1..680 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:22:01 Download gff for SD15155.complete
Subject Subject Range Query Range Percent Splice Strand
CG34232-RA 21..702 1..682 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:11:39 Download gff for SD15155.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12165623..12165719 1..97 100   Minus
2R 12164909..12165493 98..682 99 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:11:39 Download gff for SD15155.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12165623..12165719 1..97 100   Minus
2R 12164909..12165493 98..682 99 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:11:39 Download gff for SD15155.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12165623..12165719 1..97 100   Minus
2R 12164909..12165493 98..682 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:30:31 Download gff for SD15155.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8052414..8052998 98..682 99 <- Minus
arm_2R 8053128..8053224 1..97 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:20:07 Download gff for SD15155.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12166822..12166918 1..97 100   Minus
2R 12166108..12166692 98..682 99 <- Minus

SD15155.hyp Sequence

Translation from 0 to 468

> SD15155.hyp
GFTRSESFASQKQKKKKALKSISYTEAIMLKAIIVFATILVAVAMAMQPL
EDNERTHHLNHKRQLSQQHHHHHQKLQEVRHSGHDSLKHGGSHVKEHQAH
HSERKARQSHKEPGHKKSHHQKEHRQQQDNHTRKSRSHSKGSKQHHKRHT
GSRRH*

SD15155.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:22:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG34232-PC 127 CG34232-PC 1..127 29..155 696 100 Plus
CG34232-PA 127 CG34232-PA 1..127 29..155 696 100 Plus
CG34232-PB 129 CG34232-PB 7..129 33..155 678 100 Plus

SD15155.pep Sequence

Translation from 1 to 468

> SD15155.pep
GFTRSESFASQKQKKKKALKSISYTEAIMLKAIIVFATILVAVAMAMQPL
EDNERTHHLNHKRQLSQQHHHHHQKLQEVRHSGHDSLKHGGSHVKEHQAH
HSERKARQSHKEPGHKKSHHQKEHRQQQDNHTRKSRSHSKGSKQHHKRHT
GSRRH*

SD15155.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:06:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12640-PA 126 GF12640-PA 1..102 29..107 178 49.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:06:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22603-PA 122 GG22603-PA 1..122 29..155 414 71 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:15:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG34232-PC 127 CG34232-PC 1..127 29..155 696 100 Plus
CG34232-PA 127 CG34232-PA 1..127 29..155 696 100 Plus
CG34232-PB 129 CG34232-PB 7..129 33..155 678 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:06:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11025-PA 131 GL11025-PA 1..130 29..155 137 39 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:06:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20382-PA 127 GM20382-PA 1..127 29..155 495 92.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:06:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25856-PA 127 GD25856-PA 1..127 29..155 547 93.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:06:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13471-PA 133 GE13471-PA 1..133 29..155 493 78.8 Plus