BDGP Sequence Production Resources |
Search the DGRC for SD15809
Library: | SD |
Tissue Source: | Drosophila melanogaster Schneider L2 cell culture |
Created by: | Ling Hong |
Date Registered: | 1999-02-25 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 158 |
Well: | 9 |
Vector: | pOT2 |
Associated Gene/Transcript | mRpS16-RA |
Protein status: | SD15809.pep: gold |
Preliminary Size: | 390 |
Sequenced Size: | 540 |
Gene | Date | Evidence |
---|---|---|
CG8338 | 2002-01-01 | Sim4 clustering to Release 2 |
CG8338 | 2002-05-18 | Blastp of sequenced clone |
CG8338 | 2003-01-01 | Sim4 clustering to Release 3 |
mRpS16 | 2008-04-29 | Release 5.5 accounting |
mRpS16 | 2008-08-15 | Release 5.9 accounting |
mRpS16 | 2008-12-18 | 5.12 accounting |
540 bp (540 high quality bases) assembled on 2002-05-18
GenBank Submission: AY119210
> SD15809.complete AAGAATCCTTATTTTATGCCAAAACTTGTATTAGATATATAAAATATCGG GATGTCTCTATCGCCAGCCAGTGGCATTGGTCGTTTCTACGCCAAGTCGG CAAAAATCATACGTTTCGTACGCCTGGGATGCACCAATCGGCCTTTTTAT CACATTGTCGTCATGGAGAGGCGCAAGAACCAGCACCAGCCTGTCATCGA GCAGGTGGGCTCCTTTGATCCCCTGCCCAACGATTACAACGAACGACTGG TGGCCCTGAACACGGAGAGAATTCGCTATTGGCTGGGCAAAGGTGCACAC TTGTCCACGCCGGCTGCAGAACTCCTGGGAATTGCCGGACTACTGCCCAT CCACCCGCGCACCTACATGACCGCCTGGCGGAACCGGAGGACAGCTGCTG AAGCGGAGGCGTCGCCAGAAAAGGCGGAATCAACCGCATAAATATAGTTG TGCCTCAATAAAAGCCTCCTTTTCGTTTTTACGTTTAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpS16-RA | 633 | mRpS16-RA | 93..584 | 1..492 | 2445 | 99.7 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 10060678..10060845 | 1..168 | 98 | Minus | |
chr2R | 10060295..10060612 | 169..486 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS16-RA | 1..390 | 52..441 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS16-RA | 1..390 | 52..441 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS16-RA | 1..390 | 52..441 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS16-RA | 1..390 | 52..441 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS16-RA | 1..390 | 52..441 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS16-RA | 1..486 | 1..486 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS16-RA | 1..486 | 1..486 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS16-RA | 61..546 | 1..486 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS16-RA | 1..486 | 1..486 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS16-RA | 61..546 | 1..486 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 14172986..14173303 | 169..486 | 100 | <- | Minus |
2R | 14173369..14173536 | 1..168 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 14172986..14173303 | 169..486 | 100 | <- | Minus |
2R | 14173369..14173536 | 1..168 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 14172986..14173303 | 169..486 | 100 | <- | Minus |
2R | 14173369..14173536 | 1..168 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 10060491..10060808 | 169..486 | 100 | <- | Minus |
arm_2R | 10060874..10061041 | 1..168 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 14174185..14174502 | 169..486 | 100 | <- | Minus |
2R | 14174568..14174735 | 1..168 | 100 | Minus |
Translation from 51 to 440
> SD15809.pep MSLSPASGIGRFYAKSAKIIRFVRLGCTNRPFYHIVVMERRKNQHQPVIE QVGSFDPLPNDYNERLVALNTERIRYWLGKGAHLSTPAAELLGIAGLLPI HPRTYMTAWRNRRTAAEAEASPEKAESTA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12900-PA | 126 | GF12900-PA | 1..126 | 1..129 | 639 | 93.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22441-PA | 129 | GG22441-PA | 1..129 | 1..129 | 661 | 96.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH20047-PA | 131 | GH20047-PA | 1..113 | 1..113 | 562 | 89.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpS16-PA | 129 | CG8338-PA | 1..129 | 1..129 | 673 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20456-PA | 130 | GI20456-PA | 1..113 | 1..113 | 550 | 89.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17290-PA | 135 | GL17290-PA | 1..113 | 1..113 | 578 | 92.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA21001-PA | 135 | GA21001-PA | 1..113 | 1..113 | 578 | 92.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM20227-PA | 129 | GM20227-PA | 1..129 | 1..129 | 675 | 98.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD25699-PA | 129 | GD25699-PA | 1..129 | 1..129 | 674 | 98.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ22306-PA | 133 | GJ22306-PA | 1..106 | 1..106 | 533 | 92.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK21750-PA | 126 | GK21750-PA | 1..126 | 1..127 | 595 | 87.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE12332-PA | 129 | GE12332-PA | 1..129 | 1..129 | 671 | 97.7 | Plus |
Translation from 51 to 440
> SD15809.hyp MSLSPASGIGRFYAKSAKIIRFVRLGCTNRPFYHIVVMERRKNQHQPVIE QVGSFDPLPNDYNERLVALNTERIRYWLGKGAHLSTPAAELLGIAGLLPI HPRTYMTAWRNRRTAAEAEASPEKAESTA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpS16-PA | 129 | CG8338-PA | 1..129 | 1..129 | 673 | 100 | Plus |