Clone SD15809 Report

Search the DGRC for SD15809

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:158
Well:9
Vector:pOT2
Associated Gene/TranscriptmRpS16-RA
Protein status:SD15809.pep: gold
Preliminary Size:390
Sequenced Size:540

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8338 2002-01-01 Sim4 clustering to Release 2
CG8338 2002-05-18 Blastp of sequenced clone
CG8338 2003-01-01 Sim4 clustering to Release 3
mRpS16 2008-04-29 Release 5.5 accounting
mRpS16 2008-08-15 Release 5.9 accounting
mRpS16 2008-12-18 5.12 accounting

Clone Sequence Records

SD15809.complete Sequence

540 bp (540 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119210

> SD15809.complete
AAGAATCCTTATTTTATGCCAAAACTTGTATTAGATATATAAAATATCGG
GATGTCTCTATCGCCAGCCAGTGGCATTGGTCGTTTCTACGCCAAGTCGG
CAAAAATCATACGTTTCGTACGCCTGGGATGCACCAATCGGCCTTTTTAT
CACATTGTCGTCATGGAGAGGCGCAAGAACCAGCACCAGCCTGTCATCGA
GCAGGTGGGCTCCTTTGATCCCCTGCCCAACGATTACAACGAACGACTGG
TGGCCCTGAACACGGAGAGAATTCGCTATTGGCTGGGCAAAGGTGCACAC
TTGTCCACGCCGGCTGCAGAACTCCTGGGAATTGCCGGACTACTGCCCAT
CCACCCGCGCACCTACATGACCGCCTGGCGGAACCGGAGGACAGCTGCTG
AAGCGGAGGCGTCGCCAGAAAAGGCGGAATCAACCGCATAAATATAGTTG
TGCCTCAATAAAAGCCTCCTTTTCGTTTTTACGTTTAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

SD15809.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:54:37
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS16-RA 633 mRpS16-RA 93..584 1..492 2445 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:57:32
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 10060295..10060614 486..167 1600 100 Minus
chr2R 21145070 chr2R 10060678..10060845 168..1 810 98.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:55:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:57:30
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14172980..14173305 492..167 1615 99.7 Minus
2R 25286936 2R 14173369..14173536 168..1 840 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:13:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 14174179..14174504 492..167 1615 99.6 Minus
2R 25260384 2R 14174568..14174735 168..1 840 100 Minus
Blast to na_te.dros performed on 2019-03-15 19:57:30 has no hits.

SD15809.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:58:16 Download gff for SD15809.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 10060678..10060845 1..168 98   Minus
chr2R 10060295..10060612 169..486 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:08:25 Download gff for SD15809.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS16-RA 1..390 52..441 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:51:57 Download gff for SD15809.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS16-RA 1..390 52..441 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:17:05 Download gff for SD15809.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS16-RA 1..390 52..441 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:34:16 Download gff for SD15809.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS16-RA 1..390 52..441 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:11:23 Download gff for SD15809.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS16-RA 1..390 52..441 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:03:29 Download gff for SD15809.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS16-RA 1..486 1..486 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:51:57 Download gff for SD15809.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS16-RA 1..486 1..486 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:17:05 Download gff for SD15809.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS16-RA 61..546 1..486 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:34:16 Download gff for SD15809.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS16-RA 1..486 1..486 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:11:23 Download gff for SD15809.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS16-RA 61..546 1..486 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:58:16 Download gff for SD15809.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14172986..14173303 169..486 100 <- Minus
2R 14173369..14173536 1..168 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:58:16 Download gff for SD15809.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14172986..14173303 169..486 100 <- Minus
2R 14173369..14173536 1..168 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:58:16 Download gff for SD15809.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14172986..14173303 169..486 100 <- Minus
2R 14173369..14173536 1..168 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:17:05 Download gff for SD15809.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10060491..10060808 169..486 100 <- Minus
arm_2R 10060874..10061041 1..168 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:15:44 Download gff for SD15809.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14174185..14174502 169..486 100 <- Minus
2R 14174568..14174735 1..168 100   Minus

SD15809.pep Sequence

Translation from 51 to 440

> SD15809.pep
MSLSPASGIGRFYAKSAKIIRFVRLGCTNRPFYHIVVMERRKNQHQPVIE
QVGSFDPLPNDYNERLVALNTERIRYWLGKGAHLSTPAAELLGIAGLLPI
HPRTYMTAWRNRRTAAEAEASPEKAESTA*

SD15809.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:53:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12900-PA 126 GF12900-PA 1..126 1..129 639 93.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:53:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22441-PA 129 GG22441-PA 1..129 1..129 661 96.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:53:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20047-PA 131 GH20047-PA 1..113 1..113 562 89.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:08:55
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS16-PA 129 CG8338-PA 1..129 1..129 673 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:53:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20456-PA 130 GI20456-PA 1..113 1..113 550 89.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:53:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17290-PA 135 GL17290-PA 1..113 1..113 578 92.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:53:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21001-PA 135 GA21001-PA 1..113 1..113 578 92.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:53:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20227-PA 129 GM20227-PA 1..129 1..129 675 98.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:53:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25699-PA 129 GD25699-PA 1..129 1..129 674 98.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:53:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22306-PA 133 GJ22306-PA 1..106 1..106 533 92.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:53:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21750-PA 126 GK21750-PA 1..126 1..127 595 87.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:53:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12332-PA 129 GE12332-PA 1..129 1..129 671 97.7 Plus

SD15809.hyp Sequence

Translation from 51 to 440

> SD15809.hyp
MSLSPASGIGRFYAKSAKIIRFVRLGCTNRPFYHIVVMERRKNQHQPVIE
QVGSFDPLPNDYNERLVALNTERIRYWLGKGAHLSTPAAELLGIAGLLPI
HPRTYMTAWRNRRTAAEAEASPEKAESTA*

SD15809.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:05:40
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS16-PA 129 CG8338-PA 1..129 1..129 673 100 Plus