Clone SD15982 Report

Search the DGRC for SD15982

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:159
Well:82
Vector:pOT2
Associated Gene/TranscriptGC1-RA
Protein status:SD15982.pep: gold
Preliminary Size:1666
Sequenced Size:1452

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18347 2002-01-01 Sim4 clustering to Release 2
CG18347 2002-05-18 Blastp of sequenced clone
CG18347 2008-04-29 Release 5.5 accounting
CG18347 2008-08-15 Release 5.9 accounting
CG18347 2008-12-18 5.12 accounting

Clone Sequence Records

SD15982.complete Sequence

1452 bp (1452 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119214

> SD15982.complete
CTCCGCTGACCAGAATCGACGGCGACGCGCGAAGAGAATATCAATAAATA
TTTTTAATTTAGCTTAATTAGCCGCAAATAAGTGTTGCTTGTCCGCAGCA
GCCGTTAAGTTCAAAGTAACCGGAGTCAATTAATCGAGCTTCTTAGCAAC
TAGTGCAAAAATGTCGAGCAGTGCAACCATCGCAACGCCGCTGCCGCAGC
CGCAGCACCAGCAATTCGCCCTGCTGCCGAAGATCATTAACGGCGGAATT
GCGGGAATCATCGGAGTGACATGCGTCTTCCCACTGGACTTGGTCAAGAC
GAGGCTGCAAAACCAGCAGATCGGACCCAATGGCGAACGCATGTACAACA
GCATGTTCGATTGCTTCCGCAAGACGTACAAGGCCGAAGGATACTTTGGC
ATGTACCGCGGCTCTGGCGTGAACATCCTGCTAATCACACCTGAGAAGGC
CATCAAGTTGACCGCCAACGATTACTTCCGCCACAAGCTGACCACCAAGG
ATGGCAAACTTCCGCTGACCAGTCAGATGGTTGCCGGCGGTCTGGCCGGT
GCATTCCAAATTATCGTCACCACGCCCATGGAGCTTCTCAAGATCCAGAT
GCAGGATGCGGGTCGCGTGGCGGCGGCGGCCAAATTGGCTGGAAAGACGG
TGGAGAAGGTGTCGGCCACCCAATTGGCTTCCCAGCTTATCAAGGACAAG
GGCATCTTTGGCCTGTACAAGGGTATCGGTGCCACAGGACTGCGAGATGT
CACCTTCTCTATCATTTACTTCCCCCTTTTCGCTACTCTCAATGACCTGG
GTCCACGACGAAACGATGGATCTGGCGAGGCTGTGTTCTGGTGCTCCTTC
CTGGCGGGCTTGGCGGCCGGTTCCACCGCTGCCCTCGCAGTTAATCCCTT
CGACGTGGTCAAGACGCGTCTGCAGGCGATTAAGAAGGCCGACGGTGAGA
AGGAGTTCAAGGGCATATCAGATTGTATCACTAAGACACTGAAGCACGAG
GGACCCACCGCCTTCTTCAAGGGCGGCCTGTGCCGAATGATTGTGATTGC
TCCTCTGTTCGGAATCGCTCAAACGGTCTACTATCTGGGCGTGGCCGAGG
GCCTGCTGGGCTATCAGAAAAAGTAGGGCGGCTTGGAATGAGTACGCGCC
AAGGCGGATTGACAAGACCGAAGCATTTTAAATGTACTCTCTTTGAATAT
TGAATGTGTATGTATATCGTGTTTAAATGTTGTTAAAGCTGTCCATGAAT
GTAATCGTGAAGTCTCTATAGTAAGCTAAAGTAATCGAACGATGCGCCAG
CCAGCCAAGTTGTTAAAGTTTTCCCCAATCCTCTTAAACTACTCAAACGA
TGTACTACATATGTATTTAGACCATGTCAGAAGATAACTGATGCTCCAAT
GACAATAAGATAAAGCAAATTAATCGCTGAAAAAAAAAAAAAAAAAAAAA
AA

SD15982.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:00:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG18347-RA 1691 CG18347-RA 35..1464 1..1430 7075 99.6 Plus
CG18347.a 1433 CG18347.a 70..1340 160..1430 6310 99.7 Plus
CG18347.b 1433 CG18347.b 70..1340 160..1430 6310 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:37:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 7795695..7796182 355..842 2410 99.6 Plus
chr3R 27901430 chr3R 7796438..7796885 982..1429 2225 99.8 Plus
chr3R 27901430 chr3R 7793136..7793294 1..159 765 98.7 Plus
chr3R 27901430 chr3R 7796240..7796381 840..981 710 100 Plus
chr3R 27901430 chr3R 7795502..7795638 220..356 685 100 Plus
chr3R 27901430 chr3R 7794624..7794683 160..219 300 100 Plus
chr3R 27901430 chr3R 7797537..7797773 385..621 285 74.7 Plus
chr3R 27901430 chr3R 7797308..7797437 227..356 245 79.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:55:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:37:56
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11970288..11970775 355..842 2425 99.8 Plus
3R 32079331 3R 11971031..11971479 982..1430 2215 99.6 Plus
3R 32079331 3R 11967729..11967887 1..159 765 98.7 Plus
3R 32079331 3R 11970833..11970974 840..981 710 100 Plus
3R 32079331 3R 11970095..11970231 220..356 685 100 Plus
3R 32079331 3R 11969217..11969276 160..219 300 100 Plus
3R 32079331 3R 11972130..11972366 385..621 285 74.7 Plus
3R 32079331 3R 11971901..11972030 227..356 245 79.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:32:28
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 11711119..11711606 355..842 2425 99.7 Plus
3R 31820162 3R 11711862..11712310 982..1430 2215 99.5 Plus
3R 31820162 3R 11708560..11708718 1..159 765 98.7 Plus
3R 31820162 3R 11711664..11711805 840..981 710 100 Plus
3R 31820162 3R 11710926..11711062 220..356 685 100 Plus
3R 31820162 3R 11710048..11710107 160..219 300 100 Plus
3R 31820162 3R 11712732..11712861 227..356 245 79.2 Plus
3R 31820162 3R 11712961..11713047 385..471 225 83.9 Plus
3R 31820162 3R 11713109..11713197 533..621 220 83.1 Plus
Blast to na_te.dros performed 2019-03-16 08:37:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\BuT5 669 Dbuz\BuT5 BUT5 669bp 252..337 1265..1176 116 62.2 Minus

SD15982.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:38:38 Download gff for SD15982.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 7793136..7793294 1..159 98 -> Plus
chr3R 7794624..7794683 160..219 100 -> Plus
chr3R 7795502..7795636 220..354 100 -> Plus
chr3R 7795695..7796180 355..840 99 -> Plus
chr3R 7796241..7796381 841..981 100 -> Plus
chr3R 7796438..7796885 982..1429 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:08:30 Download gff for SD15982.complete
Subject Subject Range Query Range Percent Splice Strand
CG18347-RA 1..966 161..1126 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:40:49 Download gff for SD15982.complete
Subject Subject Range Query Range Percent Splice Strand
CG18347-RA 1..966 161..1126 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:52:06 Download gff for SD15982.complete
Subject Subject Range Query Range Percent Splice Strand
CG18347-RA 1..966 161..1126 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:32:43 Download gff for SD15982.complete
Subject Subject Range Query Range Percent Splice Strand
CG18347-RA 1..966 161..1126 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:45:20 Download gff for SD15982.complete
Subject Subject Range Query Range Percent Splice Strand
GC1-RA 1..966 161..1126 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:14:34 Download gff for SD15982.complete
Subject Subject Range Query Range Percent Splice Strand
CG18347-RA 1..1429 1..1429 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:40:49 Download gff for SD15982.complete
Subject Subject Range Query Range Percent Splice Strand
CG18347-RA 1..1429 1..1429 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:52:06 Download gff for SD15982.complete
Subject Subject Range Query Range Percent Splice Strand
CG18347-RA 22..1450 1..1429 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:32:43 Download gff for SD15982.complete
Subject Subject Range Query Range Percent Splice Strand
CG18347-RA 1..1429 1..1429 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:45:20 Download gff for SD15982.complete
Subject Subject Range Query Range Percent Splice Strand
GC1-RA 22..1450 1..1429 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:38:38 Download gff for SD15982.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11970095..11970229 220..354 100 -> Plus
3R 11967729..11967887 1..159 98 -> Plus
3R 11969217..11969276 160..219 100 -> Plus
3R 11970288..11970773 355..840 99 -> Plus
3R 11970834..11970974 841..981 100 -> Plus
3R 11971031..11971478 982..1429 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:38:38 Download gff for SD15982.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11970095..11970229 220..354 100 -> Plus
3R 11967729..11967887 1..159 98 -> Plus
3R 11969217..11969276 160..219 100 -> Plus
3R 11970288..11970773 355..840 99 -> Plus
3R 11970834..11970974 841..981 100 -> Plus
3R 11971031..11971478 982..1429 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:38:38 Download gff for SD15982.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11970095..11970229 220..354 100 -> Plus
3R 11967729..11967887 1..159 98 -> Plus
3R 11969217..11969276 160..219 100 -> Plus
3R 11970288..11970773 355..840 99 -> Plus
3R 11970834..11970974 841..981 100 -> Plus
3R 11971031..11971478 982..1429 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:52:06 Download gff for SD15982.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7793451..7793609 1..159 98 -> Plus
arm_3R 7794939..7794998 160..219 100 -> Plus
arm_3R 7795817..7795951 220..354 100 -> Plus
arm_3R 7796010..7796495 355..840 99 -> Plus
arm_3R 7796556..7796696 841..981 100 -> Plus
arm_3R 7796753..7797200 982..1429 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:05:11 Download gff for SD15982.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11711119..11711604 355..840 99 -> Plus
3R 11711665..11711805 841..981 100 -> Plus
3R 11711862..11712309 982..1429 99   Plus
3R 11708560..11708718 1..159 98 -> Plus
3R 11710048..11710107 160..219 100 -> Plus
3R 11710926..11711060 220..354 100 -> Plus

SD15982.pep Sequence

Translation from 160 to 1125

> SD15982.pep
MSSSATIATPLPQPQHQQFALLPKIINGGIAGIIGVTCVFPLDLVKTRLQ
NQQIGPNGERMYNSMFDCFRKTYKAEGYFGMYRGSGVNILLITPEKAIKL
TANDYFRHKLTTKDGKLPLTSQMVAGGLAGAFQIIVTTPMELLKIQMQDA
GRVAAAAKLAGKTVEKVSATQLASQLIKDKGIFGLYKGIGATGLRDVTFS
IIYFPLFATLNDLGPRRNDGSGEAVFWCSFLAGLAAGSTAALAVNPFDVV
KTRLQAIKKADGEKEFKGISDCITKTLKHEGPTAFFKGGLCRMIVIAPLF
GIAQTVYYLGVAEGLLGYQKK*

SD15982.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:21:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23042-PA 317 GF23042-PA 7..316 11..320 1512 95.8 Plus
Dana\GF23043-PA 312 GF23043-PA 4..309 11..321 1025 69.5 Plus
Dana\GF23041-PA 275 GF23041-PA 1..272 44..321 886 61.2 Plus
Dana\GF23336-PA 693 GF23336-PA 349..615 28..309 553 41.7 Plus
Dana\GF16639-PA 311 GF16639-PA 28..285 22..293 339 32.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:21:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18542-PA 321 GG18542-PA 1..321 1..321 1681 99.7 Plus
Dere\GG18553-PA 314 GG18553-PA 5..311 11..321 1094 66.9 Plus
Dere\GG11935-PA 682 GG11935-PA 336..602 28..309 552 41.7 Plus
Dere\GG17216-PA 317 GG17216-PA 34..291 22..293 315 31.5 Plus
Dere\GG12807-PA 306 GG12807-PA 1..285 7..298 297 30.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 04:21:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23533-PA 324 GH23533-PA 4..324 1..321 1600 94.1 Plus
Dgri\GH23534-PA 315 GH23534-PA 16..312 20..321 1199 73.5 Plus
Dgri\GH17431-PA 695 GH17431-PA 352..615 31..309 511 41.3 Plus
Dgri\GH15324-PA 314 GH15324-PA 30..287 22..293 306 30.5 Plus
Dgri\GH17661-PA 308 GH17661-PA 20..287 24..298 289 30.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:14:44
Subject Length Description Subject Range Query Range Score Percent Strand
GC1-PB 321 CG18347-PB 1..321 1..321 1642 100 Plus
GC1-PA 321 CG18347-PA 1..321 1..321 1642 100 Plus
GC2-PB 319 CG12201-PB 12..315 13..320 1112 67.9 Plus
GC2-PD 240 CG12201-PD 1..236 81..320 837 66.2 Plus
aralar1-PB 679 CG2139-PB 333..599 28..309 544 41.7 Plus
aralar1-PD 682 CG2139-PD 336..602 28..309 544 41.7 Plus
aralar1-PA 682 CG2139-PA 336..602 28..309 544 41.7 Plus
aralar1-PF 694 CG2139-PF 336..602 28..309 544 41.7 Plus
aralar1-PC 695 CG2139-PC 349..615 28..309 544 41.7 Plus
aralar1-PE 707 CG2139-PE 361..627 28..309 544 41.7 Plus
sea-PE 317 CG6782-PE 34..291 22..293 312 30.8 Plus
sea-PD 317 CG6782-PD 34..291 22..293 312 30.8 Plus
sea-PC 317 CG6782-PC 34..291 22..293 312 30.8 Plus
sea-PA 317 CG6782-PA 34..291 22..293 312 30.8 Plus
CG5254-PA 306 CG5254-PA 17..285 24..298 288 30.4 Plus
CG1907-PA 317 CG1907-PA 20..278 24..288 272 28.9 Plus
CG4995-PB 399 CG4995-PB 38..286 23..288 260 30.9 Plus
CG4995-PA 399 CG4995-PA 38..286 23..288 260 30.9 Plus
MME1-PA 299 CG3476-PA 19..271 26..288 259 30.2 Plus
CG4995-PD 360 CG4995-PD 6..247 26..288 258 31 Plus
CG4995-PC 360 CG4995-PC 6..247 26..288 258 31 Plus
colt-PD 306 CG3057-PD 20..273 26..288 253 28.7 Plus
colt-PA 306 CG3057-PA 20..273 26..288 253 28.7 Plus
CG18418-PA 311 CG18418-PA 17..271 24..288 250 28 Plus
CG2616-PB 449 CG2616-PB 87..409 18..302 248 27.6 Plus
CG2616-PA 449 CG2616-PA 87..409 18..302 248 27.6 Plus
CG9582-PB 300 CG9582-PB 16..279 24..298 246 29.4 Plus
CG9582-PA 300 CG9582-PA 16..279 24..298 246 29.4 Plus
CG7514-PA 301 CG7514-PA 17..270 26..293 243 29.5 Plus
CG32103-PD 350 CG32103-PD 56..338 25..307 239 26.7 Plus
CG32103-PC 363 CG32103-PC 69..351 25..307 239 26.7 Plus
CG32103-PE 583 CG32103-PE 289..571 25..307 239 26.7 Plus
CG32103-PB 583 CG32103-PB 289..571 25..307 239 26.7 Plus
Ant2-PC 307 CG1683-PC 17..288 20..294 224 25.2 Plus
Ant2-PB 307 CG1683-PB 17..288 20..294 224 25.2 Plus
Ant2-PA 307 CG1683-PA 17..288 20..294 224 25.2 Plus
Bmcp-PB 303 CG7314-PB 11..288 26..298 222 26.7 Plus
Bmcp-PA 303 CG7314-PA 11..288 26..298 222 26.7 Plus
sesB-PE 299 CG16944-PE 17..280 28..294 221 25 Plus
sesB-PB 299 CG16944-PB 17..280 28..294 221 25 Plus
sesB-PA 299 CG16944-PA 17..280 28..294 221 25 Plus
sesB-PD 312 CG16944-PD 30..293 28..294 221 25 Plus
sesB-PC 312 CG16944-PC 30..293 28..294 221 25 Plus
CG18327-PB 304 CG18327-PB 9..271 28..288 213 27 Plus
CG18327-PA 304 CG18327-PA 9..271 28..288 213 27 Plus
DPCoAC-PD 364 CG4241-PD 59..348 5..309 204 26 Plus
DPCoAC-PF 365 CG4241-PF 59..349 5..309 203 26 Plus
DPCoAC-PC 365 CG4241-PC 59..349 5..309 203 26 Plus
DPCoAC-PA 365 CG4241-PA 59..349 5..309 203 26 Plus
Ucp4B-PA 337 CG18340-PA 55..316 40..298 196 25.6 Plus
Ucp4A-PB 340 CG6492-PB 49..319 30..298 194 27.1 Plus
CG18327-PB 304 CG18327-PB 112..293 28..210 188 26.5 Plus
CG18327-PA 304 CG18327-PA 112..293 28..210 188 26.5 Plus
CG18418-PA 311 CG18418-PA 12..177 117..290 166 26.1 Plus
colt-PD 306 CG3057-PD 120..280 26..195 162 27.9 Plus
colt-PA 306 CG3057-PA 120..280 26..195 162 27.9 Plus
colt-PD 306 CG3057-PD 20..196 124..307 157 26.6 Plus
colt-PA 306 CG3057-PA 20..196 124..307 157 26.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 04:21:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23551-PA 327 GI23551-PA 16..327 10..321 1506 94.9 Plus
Dmoj\GI22760-PA 695 GI22760-PA 352..615 31..309 518 41.1 Plus
Dmoj\GI22454-PA 319 GI22454-PA 35..306 22..307 328 32.4 Plus
Dmoj\GI21513-PA 310 GI21513-PA 20..289 24..298 296 29.6 Plus
Dmoj\GI11957-PA 273 GI11957-PA 1..251 33..298 273 28 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:21:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22256-PA 321 GL22256-PA 1..321 1..321 1586 92.2 Plus
Dper\GL22257-PA 312 GL22257-PA 4..312 13..321 1462 92.9 Plus
Dper\GL22258-PA 315 GL22258-PA 4..312 13..321 1110 69.3 Plus
Dper\GL14047-PA 689 GL14047-PA 349..615 28..309 550 41.7 Plus
Dper\GL23888-PA 301 GL23888-PA 18..275 22..293 342 33.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:21:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14898-PA 321 GA14898-PA 1..321 1..321 1586 92.2 Plus
Dpse\GA27431-PA 315 GA27431-PA 4..312 13..321 1107 69.3 Plus
Dpse\GA15263-PA 689 GA15263-PA 349..615 28..309 551 41.7 Plus
Dpse\GA27430-PA 131 GA27430-PA 1..92 123..215 412 90.3 Plus
Dpse\GA27089-PA 303 GA27089-PA 20..277 22..293 342 33.3 Plus
Dpse\GA27430-PA 131 GA27430-PA 85..131 275..321 232 93.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:21:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23990-PA 321 GM23990-PA 1..321 1..321 1670 99.1 Plus
Dsec\GM23991-PA 325 GM23991-PA 22..321 17..320 1140 68.4 Plus
Dsec\GM12154-PA 682 GM12154-PA 336..602 28..309 546 41.3 Plus
Dsec\GM26094-PA 317 GM26094-PA 34..291 22..293 314 31.9 Plus
Dsec\GM19087-PA 306 GM19087-PA 17..285 24..298 292 30.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:21:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18793-PA 321 GD18793-PA 1..321 1..321 1675 99.4 Plus
Dsim\GD17068-PA 669 GD17068-PA 336..469 28..160 347 47.8 Plus
Dsim\GD20656-PA 317 GD20656-PA 34..291 22..293 313 31.9 Plus
Dsim\GD16525-PA 306 GD16525-PA 17..285 24..298 292 30.4 Plus
Dsim\GD22366-PA 300 GD22366-PA 16..269 24..288 269 30.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:21:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23511-PA 326 GJ23511-PA 16..326 10..321 1482 94.2 Plus
Dvir\GJ23512-PA 306 GJ23512-PA 8..303 20..321 1132 74.2 Plus
Dvir\GJ22761-PA 695 GJ22761-PA 352..615 31..309 518 41.6 Plus
Dvir\GJ14089-PA 312 GJ14089-PA 11..291 10..298 328 31.3 Plus
Dvir\GJ10052-PA 319 GJ10052-PA 53..292 40..293 295 31.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:21:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11426-PA 324 GK11426-PA 13..324 10..321 1592 96.5 Plus
Dwil\GK11427-PA 314 GK11427-PA 7..311 17..321 1103 72.1 Plus
Dwil\GK13128-PA 679 GK13128-PA 336..602 28..309 551 41.7 Plus
Dwil\GK11377-PA 296 GK11377-PA 9..263 22..293 309 32.6 Plus
Dwil\GK11788-PA 317 GK11788-PA 34..291 22..293 304 31.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:21:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26151-PA 321 GE26151-PA 1..321 1..321 1667 98.8 Plus
Dyak\GE26153-PA 314 GE26153-PA 5..311 11..321 1118 69.5 Plus
Dyak\GE23386-PA 682 GE23386-PA 336..602 28..309 555 41.7 Plus
Dyak\GE10110-PA 317 GE10110-PA 34..291 22..293 305 32.2 Plus
Dyak\GE10109-PA 317 GE10109-PA 52..291 40..293 302 31.8 Plus

SD15982.hyp Sequence

Translation from 160 to 1125

> SD15982.hyp
MSSSATIATPLPQPQHQQFALLPKIINGGIAGIIGVTCVFPLDLVKTRLQ
NQQIGPNGERMYNSMFDCFRKTYKAEGYFGMYRGSGVNILLITPEKAIKL
TANDYFRHKLTTKDGKLPLTSQMVAGGLAGAFQIIVTTPMELLKIQMQDA
GRVAAAAKLAGKTVEKVSATQLASQLIKDKGIFGLYKGIGATGLRDVTFS
IIYFPLFATLNDLGPRRNDGSGEAVFWCSFLAGLAAGSTAALAVNPFDVV
KTRLQAIKKADGEKEFKGISDCITKTLKHEGPTAFFKGGLCRMIVIAPLF
GIAQTVYYLGVAEGLLGYQKK*

SD15982.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:13:28
Subject Length Description Subject Range Query Range Score Percent Strand
GC1-PB 321 CG18347-PB 1..321 1..321 1642 100 Plus
GC1-PA 321 CG18347-PA 1..321 1..321 1642 100 Plus
GC2-PB 319 CG12201-PB 12..315 13..320 1112 67.9 Plus
GC2-PD 240 CG12201-PD 1..236 81..320 837 66.2 Plus
aralar1-PB 679 CG2139-PB 333..599 28..309 544 41.7 Plus