BDGP Sequence Production Resources |
Search the DGRC for SD16138
Library: | SD |
Tissue Source: | Drosophila melanogaster Schneider L2 cell culture |
Created by: | Ling Hong |
Date Registered: | 1999-02-25 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 161 |
Well: | 38 |
Vector: | pOT2 |
Associated Gene/Transcript | CG7484-RB |
Protein status: | SD16138.pep: gold |
Preliminary Size: | 429 |
Sequenced Size: | 663 |
Gene | Date | Evidence |
---|---|---|
CG7484 | 2002-01-01 | Sim4 clustering to Release 2 |
CG7484 | 2002-05-18 | Blastp of sequenced clone |
CG7484 | 2003-01-01 | Sim4 clustering to Release 3 |
CG7484 | 2008-04-29 | Release 5.5 accounting |
CG7484 | 2008-08-15 | Release 5.9 accounting |
CG7484 | 2008-12-18 | 5.12 accounting |
663 bp (663 high quality bases) assembled on 2002-05-18
GenBank Submission: AY119218
> SD16138.complete AAATTTTGTAAACAACGACGTGGACGTAGTAAATTTAATTAGAATTTAGC CACAAAAATGCATAAATGTGCTATATTTCTTCTACTGGCTTTAAGTTGCC AGCAAATTCAAGCCGAATTGACGGCCGCCGACTGCCGGGCGTTGGGTTTT ATTAAGGCCCAGTTAATGTGTTCCAGTTGCGAAAAACTGGATGATTTCGG ATTGGATACCATCAAGCCTCAGTGTAAGCAATGCTGCACTTTGGATCAGC AGCCGGCGGCACAGCGGACATATGCCAAGGCAATTCTGGAGGTGTGCACC TGCAAATTCCGGGCCTATCCGCAGATTCAGGCCTTTATTCAAAGCGGCCG ACCTGCCAAGTTCCCCAACCTGCAGATCAAATACGTAAGAGGACTGGATC CCGTGGTTAAGCTCCTAGATGCCAGTGGCAAAGTGCAGGAGACGTTGTCC ATAACCAAGTGGAACACAGACACTGTCGAGGAGTTCTTCGAAACGCATCT GGCCAAGGATGGTGCCGGCAAGAATTCGTACAGCGTGGTGGAGGATGCCG ATGGAGATGACGATGAAGATTACCTGCGAACCAACAGGATCTAAAATAAG CATACCCAAAACTGTAGATTAATAAAATCCGAAACAAAACTATAAAAAAA AAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG7484-RB | 762 | CG7484-RB | 32..675 | 1..644 | 3220 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 17644809..17645240 | 212..643 | 2145 | 99.8 | Plus |
chr3L | 24539361 | chr3L | 17644377..17644496 | 97..216 | 600 | 100 | Plus |
chr3L | 24539361 | chr3L | 17644226..17644321 | 1..96 | 480 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 17648314..17648746 | 212..644 | 2150 | 99.7 | Plus |
3L | 28103327 | 3L | 17647882..17648001 | 97..216 | 600 | 100 | Plus |
3L | 28103327 | 3L | 17647731..17647826 | 1..96 | 480 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 17644226..17644321 | 1..96 | 100 | -> | Plus |
chr3L | 17644377..17644495 | 97..215 | 100 | -> | Plus |
chr3L | 17644813..17645240 | 216..643 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7484-RB | 1..537 | 58..594 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7484-RB | 1..537 | 58..594 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7484-RB | 1..537 | 58..594 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7484-RB | 1..537 | 58..594 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7484-RB | 1..537 | 58..594 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7484-RB | 1..643 | 1..643 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7484-RB | 1..643 | 1..643 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7484-RB | 15..657 | 1..643 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7484-RB | 1..643 | 1..643 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7484-RB | 15..657 | 1..643 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 17654782..17654900 | 97..215 | 100 | -> | Plus |
3L | 17654631..17654726 | 1..96 | 100 | -> | Plus |
3L | 17655218..17655645 | 216..643 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 17654782..17654900 | 97..215 | 100 | -> | Plus |
3L | 17654631..17654726 | 1..96 | 100 | -> | Plus |
3L | 17655218..17655645 | 216..643 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 17654782..17654900 | 97..215 | 100 | -> | Plus |
3L | 17654631..17654726 | 1..96 | 100 | -> | Plus |
3L | 17655218..17655645 | 216..643 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 17647731..17647826 | 1..96 | 100 | -> | Plus |
arm_3L | 17647882..17648000 | 97..215 | 100 | -> | Plus |
arm_3L | 17648318..17648745 | 216..643 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 17648318..17648745 | 216..643 | 100 | Plus | |
3L | 17647731..17647826 | 1..96 | 100 | -> | Plus |
3L | 17647882..17648000 | 97..215 | 100 | -> | Plus |
Translation from 57 to 593
> SD16138.pep MHKCAIFLLLALSCQQIQAELTAADCRALGFIKAQLMCSSCEKLDDFGLD TIKPQCKQCCTLDQQPAAQRTYAKAILEVCTCKFRAYPQIQAFIQSGRPA KFPNLQIKYVRGLDPVVKLLDASGKVQETLSITKWNTDTVEEFFETHLAK DGAGKNSYSVVEDADGDDDEDYLRTNRI*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF13902-PA | 178 | GF13902-PA | 1..178 | 1..178 | 805 | 89.3 | Plus |
Dana\GF13371-PA | 58 | GF13371-PA | 14..58 | 134..178 | 173 | 86.7 | Plus |
Dana\GF11788-PA | 226 | GF11788-PA | 182..226 | 134..178 | 171 | 86.7 | Plus |
Dana\GF18922-PA | 223 | GF18922-PA | 179..223 | 134..178 | 171 | 86.7 | Plus |
Dana\GF10544-PA | 225 | GF10544-PA | 182..225 | 134..178 | 161 | 80 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG13628-PA | 177 | GG13628-PA | 1..177 | 1..178 | 907 | 97.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH16126-PA | 185 | GH16126-PA | 1..185 | 1..178 | 730 | 79.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG7484-PB | 178 | CG7484-PB | 1..178 | 1..178 | 937 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI12390-PA | 181 | GI12390-PA | 1..181 | 1..178 | 737 | 81.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24911-PA | 179 | GL24911-PA | 1..179 | 1..178 | 769 | 84.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA20385-PA | 178 | GA20385-PA | 1..178 | 1..178 | 787 | 84.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25714-PA | 178 | GM25714-PA | 1..178 | 1..178 | 927 | 97.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD17646-PA | 178 | GD17646-PA | 1..178 | 1..178 | 924 | 98.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12280-PA | 177 | GJ12280-PA | 12..177 | 12..178 | 709 | 85 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK12298-PA | 1021 | GK12298-PA | 852..1021 | 15..178 | 724 | 85.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE19924-PA | 178 | GE19924-PA | 1..178 | 1..178 | 918 | 97.2 | Plus |
Translation from 57 to 593
> SD16138.hyp MHKCAIFLLLALSCQQIQAELTAADCRALGFIKAQLMCSSCEKLDDFGLD TIKPQCKQCCTLDQQPAAQRTYAKAILEVCTCKFRAYPQIQAFIQSGRPA KFPNLQIKYVRGLDPVVKLLDASGKVQETLSITKWNTDTVEEFFETHLAK DGAGKNSYSVVEDADGDDDEDYLRTNRI*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG7484-PB | 178 | CG7484-PB | 1..178 | 1..178 | 937 | 100 | Plus |