Clone SD16138 Report

Search the DGRC for SD16138

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:161
Well:38
Vector:pOT2
Associated Gene/TranscriptCG7484-RB
Protein status:SD16138.pep: gold
Preliminary Size:429
Sequenced Size:663

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7484 2002-01-01 Sim4 clustering to Release 2
CG7484 2002-05-18 Blastp of sequenced clone
CG7484 2003-01-01 Sim4 clustering to Release 3
CG7484 2008-04-29 Release 5.5 accounting
CG7484 2008-08-15 Release 5.9 accounting
CG7484 2008-12-18 5.12 accounting

Clone Sequence Records

SD16138.complete Sequence

663 bp (663 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119218

> SD16138.complete
AAATTTTGTAAACAACGACGTGGACGTAGTAAATTTAATTAGAATTTAGC
CACAAAAATGCATAAATGTGCTATATTTCTTCTACTGGCTTTAAGTTGCC
AGCAAATTCAAGCCGAATTGACGGCCGCCGACTGCCGGGCGTTGGGTTTT
ATTAAGGCCCAGTTAATGTGTTCCAGTTGCGAAAAACTGGATGATTTCGG
ATTGGATACCATCAAGCCTCAGTGTAAGCAATGCTGCACTTTGGATCAGC
AGCCGGCGGCACAGCGGACATATGCCAAGGCAATTCTGGAGGTGTGCACC
TGCAAATTCCGGGCCTATCCGCAGATTCAGGCCTTTATTCAAAGCGGCCG
ACCTGCCAAGTTCCCCAACCTGCAGATCAAATACGTAAGAGGACTGGATC
CCGTGGTTAAGCTCCTAGATGCCAGTGGCAAAGTGCAGGAGACGTTGTCC
ATAACCAAGTGGAACACAGACACTGTCGAGGAGTTCTTCGAAACGCATCT
GGCCAAGGATGGTGCCGGCAAGAATTCGTACAGCGTGGTGGAGGATGCCG
ATGGAGATGACGATGAAGATTACCTGCGAACCAACAGGATCTAAAATAAG
CATACCCAAAACTGTAGATTAATAAAATCCGAAACAAAACTATAAAAAAA
AAAAAAAAAAAAA

SD16138.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:00:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG7484-RB 762 CG7484-RB 32..675 1..644 3220 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:44:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 17644809..17645240 212..643 2145 99.8 Plus
chr3L 24539361 chr3L 17644377..17644496 97..216 600 100 Plus
chr3L 24539361 chr3L 17644226..17644321 1..96 480 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:56:05 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:44:38
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 17655214..17655646 212..644 2150 99.8 Plus
3L 28110227 3L 17654782..17654901 97..216 600 100 Plus
3L 28110227 3L 17654631..17654726 1..96 480 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:32:21
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 17648314..17648746 212..644 2150 99.7 Plus
3L 28103327 3L 17647882..17648001 97..216 600 100 Plus
3L 28103327 3L 17647731..17647826 1..96 480 100 Plus
Blast to na_te.dros performed on 2019-03-15 20:44:39 has no hits.

SD16138.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:45:25 Download gff for SD16138.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 17644226..17644321 1..96 100 -> Plus
chr3L 17644377..17644495 97..215 100 -> Plus
chr3L 17644813..17645240 216..643 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:08:35 Download gff for SD16138.complete
Subject Subject Range Query Range Percent Splice Strand
CG7484-RB 1..537 58..594 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:40:36 Download gff for SD16138.complete
Subject Subject Range Query Range Percent Splice Strand
CG7484-RB 1..537 58..594 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:19:34 Download gff for SD16138.complete
Subject Subject Range Query Range Percent Splice Strand
CG7484-RB 1..537 58..594 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:32:32 Download gff for SD16138.complete
Subject Subject Range Query Range Percent Splice Strand
CG7484-RB 1..537 58..594 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:27:25 Download gff for SD16138.complete
Subject Subject Range Query Range Percent Splice Strand
CG7484-RB 1..537 58..594 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:14:18 Download gff for SD16138.complete
Subject Subject Range Query Range Percent Splice Strand
CG7484-RB 1..643 1..643 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:40:36 Download gff for SD16138.complete
Subject Subject Range Query Range Percent Splice Strand
CG7484-RB 1..643 1..643 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:19:34 Download gff for SD16138.complete
Subject Subject Range Query Range Percent Splice Strand
CG7484-RB 15..657 1..643 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:32:32 Download gff for SD16138.complete
Subject Subject Range Query Range Percent Splice Strand
CG7484-RB 1..643 1..643 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:27:25 Download gff for SD16138.complete
Subject Subject Range Query Range Percent Splice Strand
CG7484-RB 15..657 1..643 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:45:25 Download gff for SD16138.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17654782..17654900 97..215 100 -> Plus
3L 17654631..17654726 1..96 100 -> Plus
3L 17655218..17655645 216..643 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:45:25 Download gff for SD16138.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17654782..17654900 97..215 100 -> Plus
3L 17654631..17654726 1..96 100 -> Plus
3L 17655218..17655645 216..643 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:45:25 Download gff for SD16138.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17654782..17654900 97..215 100 -> Plus
3L 17654631..17654726 1..96 100 -> Plus
3L 17655218..17655645 216..643 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:19:34 Download gff for SD16138.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 17647731..17647826 1..96 100 -> Plus
arm_3L 17647882..17648000 97..215 100 -> Plus
arm_3L 17648318..17648745 216..643 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:04:58 Download gff for SD16138.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17648318..17648745 216..643 100   Plus
3L 17647731..17647826 1..96 100 -> Plus
3L 17647882..17648000 97..215 100 -> Plus

SD16138.pep Sequence

Translation from 57 to 593

> SD16138.pep
MHKCAIFLLLALSCQQIQAELTAADCRALGFIKAQLMCSSCEKLDDFGLD
TIKPQCKQCCTLDQQPAAQRTYAKAILEVCTCKFRAYPQIQAFIQSGRPA
KFPNLQIKYVRGLDPVVKLLDASGKVQETLSITKWNTDTVEEFFETHLAK
DGAGKNSYSVVEDADGDDDEDYLRTNRI*

SD16138.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:18:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13902-PA 178 GF13902-PA 1..178 1..178 805 89.3 Plus
Dana\GF13371-PA 58 GF13371-PA 14..58 134..178 173 86.7 Plus
Dana\GF11788-PA 226 GF11788-PA 182..226 134..178 171 86.7 Plus
Dana\GF18922-PA 223 GF18922-PA 179..223 134..178 171 86.7 Plus
Dana\GF10544-PA 225 GF10544-PA 182..225 134..178 161 80 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:18:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13628-PA 177 GG13628-PA 1..177 1..178 907 97.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 04:18:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16126-PA 185 GH16126-PA 1..185 1..178 730 79.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:25:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG7484-PB 178 CG7484-PB 1..178 1..178 937 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 04:18:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12390-PA 181 GI12390-PA 1..181 1..178 737 81.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:18:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24911-PA 179 GL24911-PA 1..179 1..178 769 84.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:18:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20385-PA 178 GA20385-PA 1..178 1..178 787 84.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:18:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25714-PA 178 GM25714-PA 1..178 1..178 927 97.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:18:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17646-PA 178 GD17646-PA 1..178 1..178 924 98.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:18:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12280-PA 177 GJ12280-PA 12..177 12..178 709 85 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:18:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12298-PA 1021 GK12298-PA 852..1021 15..178 724 85.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:18:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19924-PA 178 GE19924-PA 1..178 1..178 918 97.2 Plus

SD16138.hyp Sequence

Translation from 57 to 593

> SD16138.hyp
MHKCAIFLLLALSCQQIQAELTAADCRALGFIKAQLMCSSCEKLDDFGLD
TIKPQCKQCCTLDQQPAAQRTYAKAILEVCTCKFRAYPQIQAFIQSGRPA
KFPNLQIKYVRGLDPVVKLLDASGKVQETLSITKWNTDTVEEFFETHLAK
DGAGKNSYSVVEDADGDDDEDYLRTNRI*

SD16138.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:14:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG7484-PB 178 CG7484-PB 1..178 1..178 937 100 Plus