BDGP Sequence Production Resources |
Search the DGRC for SD16185
Library: | SD |
Tissue Source: | Drosophila melanogaster Schneider L2 cell culture |
Created by: | Ling Hong |
Date Registered: | 1999-02-25 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 161 |
Well: | 85 |
Vector: | pOT2 |
Associated Gene/Transcript | dod-RA |
Protein status: | SD16185.pep: gold |
Sequenced Size: | 649 |
Gene | Date | Evidence |
---|---|---|
dod | 2009-06-08 | Manual selection by Joe Carlson |
649 bp assembled on 2009-08-11
GenBank Submission: BT099557.1
> SD16185.complete CCGAAAACTATTTGTAATTTAACTCAAATTAAGTGAAAACAGCATGCCAG ATGCCGAGCAACTACCGGACGGCTGGGAGAAGCGCACTAGCCGCTCCACA GGAATGAGCTATTATCTCAATATGTACACAAAGGAGTCGCAGTGGGATCA GCCCACAGAGCCGGCGAAGAAGGCGGGCGGAGGATCCGCCGGCGGCGGAG ATGCACCGGACGAGGTGCATTGCCTGCATCTGCTGGTTAAGCACAAGGGC AGTCGGCGTCCCAGCTCGTGGCGCGAGGCGAACATCACGCGCACCAAGGA GGAGGCCCAGCTGCTCCTCGAGGTCTATCGCAACAAAATCGTCCAGCAGG AGGCCACATTCGACGAGCTGGCCCGCTCCTACTCCGACTGCAGCTCCGCC AAGAGGGGCGGCGACCTGGGAAAGTTCGGCAGAGGTCAGATGCAGGCGGC TTTCGAGGACGCTGCCTTCAAATTGAACGTCAACCAGCTGTCGGGCATCG TCGACAGCGACTCCGGCCTGCACATCATCCTGCGCAAGGCATAGACTCAT CGAGCACCGACCCACAGCACAACTCGCGTCCCTTCACATGAATAAAACGG AATGCCCAGCCATTTCAATATAGAATTAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
dod-RA | 1113 | dod-RA | 137..764 | 1..628 | 3140 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chrX | 22417052 | chrX | 21210775..21211112 | 99..436 | 1690 | 100 | Plus |
chrX | 22417052 | chrX | 21211478..21211672 | 433..627 | 975 | 100 | Plus |
chrX | 22417052 | chrX | 21210566..21210667 | 1..102 | 510 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 21210566..21210666 | 1..101 | 100 | -> | Plus |
chrX | 21210778..21211110 | 102..434 | 100 | -> | Plus |
chrX | 21211480..21211672 | 435..627 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
dod-RA | 1..501 | 44..544 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
dod-RA | 1..501 | 44..544 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
dod-RA | 1..501 | 44..544 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
dod-RA | 1..501 | 44..544 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
dod-RA | 29..655 | 1..627 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
dod-RA | 61..687 | 1..627 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
dod-RA | 51..677 | 1..627 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
dod-RA | 51..677 | 1..627 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 21345408..21345508 | 1..101 | 100 | -> | Plus |
X | 21345620..21345952 | 102..434 | 100 | -> | Plus |
X | 21346322..21346514 | 435..627 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 21345408..21345508 | 1..101 | 100 | -> | Plus |
X | 21345620..21345952 | 102..434 | 100 | -> | Plus |
X | 21346322..21346514 | 435..627 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 21345408..21345508 | 1..101 | 100 | -> | Plus |
X | 21345620..21345952 | 102..434 | 100 | -> | Plus |
X | 21346322..21346514 | 435..627 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 21216435..21216535 | 1..101 | 100 | -> | Plus |
arm_X | 21216647..21216979 | 102..434 | 100 | -> | Plus |
arm_X | 21217349..21217541 | 435..627 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 21330712..21331044 | 102..434 | 100 | -> | Plus |
X | 21331414..21331606 | 435..627 | 100 | Plus | |
X | 21330500..21330600 | 1..101 | 100 | -> | Plus |
Translation from 43 to 543
> SD16185.pep MPDAEQLPDGWEKRTSRSTGMSYYLNMYTKESQWDQPTEPAKKAGGGSAG GGDAPDEVHCLHLLVKHKGSRRPSSWREANITRTKEEAQLLLEVYRNKIV QQEATFDELARSYSDCSSAKRGGDLGKFGRGQMQAAFEDAAFKLNVNQLS GIVDSDSGLHIILRKA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF22548-PA | 173 | GF22548-PA | 1..173 | 1..166 | 726 | 85.5 | Plus |
Dana\GF15934-PA | 389 | GF15934-PA | 91..246 | 6..164 | 206 | 33.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG19723-PA | 169 | GG19723-PA | 1..169 | 1..166 | 790 | 89.3 | Plus |
Dere\GG14671-PA | 381 | GG14671-PA | 72..229 | 6..164 | 250 | 36.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH24043-PA | 165 | GH24043-PA | 1..165 | 1..166 | 709 | 81.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
dod-PA | 166 | CG17051-PA | 1..166 | 1..166 | 871 | 100 | Plus |
CG32845-PA | 386 | CG32845-PA | 72..235 | 6..164 | 244 | 37.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI15719-PA | 164 | GI15719-PA | 1..164 | 1..166 | 747 | 83.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL14862-PA | 163 | GL14862-PA | 1..163 | 1..166 | 741 | 84.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA14299-PA | 163 | GA14299-PA | 1..163 | 1..166 | 741 | 84.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM23077-PA | 166 | GM23077-PA | 1..166 | 1..166 | 787 | 95.8 | Plus |
Dsec\GM14286-PA | 374 | GM14286-PA | 74..239 | 6..164 | 266 | 36.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD17528-PA | 166 | GD17528-PA | 1..166 | 1..166 | 851 | 95.2 | Plus |
Dsim\GD25716-PA | 374 | GD25716-PA | 74..239 | 6..164 | 265 | 36.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ15247-PA | 165 | GJ15247-PA | 1..165 | 1..166 | 745 | 83.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK10078-PA | 167 | GK10078-PA | 1..167 | 1..166 | 735 | 83.8 | Plus |
Translation from 43 to 543
> SD16185.hyp MPDAEQLPDGWEKRTSRSTGMSYYLNMYTKESQWDQPTEPAKKAGGGSAG GGDAPDEVHCLHLLVKHKGSRRPSSWREANITRTKEEAQLLLEVYRNKIV QQEATFDELARSYSDCSSAKRGGDLGKFGRGQMQAAFEDAAFKLNVNQLS GIVDSDSGLHIILRKA*