Clone SD16185 Report

Search the DGRC for SD16185

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:161
Well:85
Vector:pOT2
Associated Gene/Transcriptdod-RA
Protein status:SD16185.pep: gold
Sequenced Size:649

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
dod 2009-06-08 Manual selection by Joe Carlson

Clone Sequence Records

SD16185.complete Sequence

649 bp assembled on 2009-08-11

GenBank Submission: BT099557.1

> SD16185.complete
CCGAAAACTATTTGTAATTTAACTCAAATTAAGTGAAAACAGCATGCCAG
ATGCCGAGCAACTACCGGACGGCTGGGAGAAGCGCACTAGCCGCTCCACA
GGAATGAGCTATTATCTCAATATGTACACAAAGGAGTCGCAGTGGGATCA
GCCCACAGAGCCGGCGAAGAAGGCGGGCGGAGGATCCGCCGGCGGCGGAG
ATGCACCGGACGAGGTGCATTGCCTGCATCTGCTGGTTAAGCACAAGGGC
AGTCGGCGTCCCAGCTCGTGGCGCGAGGCGAACATCACGCGCACCAAGGA
GGAGGCCCAGCTGCTCCTCGAGGTCTATCGCAACAAAATCGTCCAGCAGG
AGGCCACATTCGACGAGCTGGCCCGCTCCTACTCCGACTGCAGCTCCGCC
AAGAGGGGCGGCGACCTGGGAAAGTTCGGCAGAGGTCAGATGCAGGCGGC
TTTCGAGGACGCTGCCTTCAAATTGAACGTCAACCAGCTGTCGGGCATCG
TCGACAGCGACTCCGGCCTGCACATCATCCTGCGCAAGGCATAGACTCAT
CGAGCACCGACCCACAGCACAACTCGCGTCCCTTCACATGAATAAAACGG
AATGCCCAGCCATTTCAATATAGAATTAAAAAAAAAAAAAAAAAAAAAA

SD16185.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:30:16
Subject Length Description Subject Range Query Range Score Percent Strand
dod-RA 1113 dod-RA 137..764 1..628 3140 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:10:25
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 21210775..21211112 99..436 1690 100 Plus
chrX 22417052 chrX 21211478..21211672 433..627 975 100 Plus
chrX 22417052 chrX 21210566..21210667 1..102 510 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:56:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:10:23
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 21345617..21345954 99..436 1690 100 Plus
X 23542271 X 21346320..21346515 433..628 980 100 Plus
X 23542271 X 21345408..21345509 1..102 510 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:26:02
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 21330709..21331046 99..436 1690 100 Plus
X 23527363 X 21331412..21331607 433..628 980 100 Plus
X 23527363 X 21330500..21330601 1..102 510 100 Plus
Blast to na_te.dros performed on 2019-03-16 02:10:23 has no hits.

SD16185.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:11:07 Download gff for SD16185.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 21210566..21210666 1..101 100 -> Plus
chrX 21210778..21211110 102..434 100 -> Plus
chrX 21211480..21211672 435..627 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:13:46 Download gff for SD16185.complete
Subject Subject Range Query Range Percent Splice Strand
dod-RA 1..501 44..544 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:58:03 Download gff for SD16185.complete
Subject Subject Range Query Range Percent Splice Strand
dod-RA 1..501 44..544 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:43:34 Download gff for SD16185.complete
Subject Subject Range Query Range Percent Splice Strand
dod-RA 1..501 44..544 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:59:45 Download gff for SD16185.complete
Subject Subject Range Query Range Percent Splice Strand
dod-RA 1..501 44..544 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-08-11 18:54:17 Download gff for SD16185.complete
Subject Subject Range Query Range Percent Splice Strand
dod-RA 29..655 1..627 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:58:03 Download gff for SD16185.complete
Subject Subject Range Query Range Percent Splice Strand
dod-RA 61..687 1..627 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:43:34 Download gff for SD16185.complete
Subject Subject Range Query Range Percent Splice Strand
dod-RA 51..677 1..627 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:59:45 Download gff for SD16185.complete
Subject Subject Range Query Range Percent Splice Strand
dod-RA 51..677 1..627 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:11:07 Download gff for SD16185.complete
Subject Subject Range Query Range Percent Splice Strand
X 21345408..21345508 1..101 100 -> Plus
X 21345620..21345952 102..434 100 -> Plus
X 21346322..21346514 435..627 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:11:07 Download gff for SD16185.complete
Subject Subject Range Query Range Percent Splice Strand
X 21345408..21345508 1..101 100 -> Plus
X 21345620..21345952 102..434 100 -> Plus
X 21346322..21346514 435..627 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:11:07 Download gff for SD16185.complete
Subject Subject Range Query Range Percent Splice Strand
X 21345408..21345508 1..101 100 -> Plus
X 21345620..21345952 102..434 100 -> Plus
X 21346322..21346514 435..627 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:43:34 Download gff for SD16185.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 21216435..21216535 1..101 100 -> Plus
arm_X 21216647..21216979 102..434 100 -> Plus
arm_X 21217349..21217541 435..627 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:49:40 Download gff for SD16185.complete
Subject Subject Range Query Range Percent Splice Strand
X 21330712..21331044 102..434 100 -> Plus
X 21331414..21331606 435..627 100   Plus
X 21330500..21330600 1..101 100 -> Plus

SD16185.pep Sequence

Translation from 43 to 543

> SD16185.pep
MPDAEQLPDGWEKRTSRSTGMSYYLNMYTKESQWDQPTEPAKKAGGGSAG
GGDAPDEVHCLHLLVKHKGSRRPSSWREANITRTKEEAQLLLEVYRNKIV
QQEATFDELARSYSDCSSAKRGGDLGKFGRGQMQAAFEDAAFKLNVNQLS
GIVDSDSGLHIILRKA*

SD16185.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:50:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22548-PA 173 GF22548-PA 1..173 1..166 726 85.5 Plus
Dana\GF15934-PA 389 GF15934-PA 91..246 6..164 206 33.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:50:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19723-PA 169 GG19723-PA 1..169 1..166 790 89.3 Plus
Dere\GG14671-PA 381 GG14671-PA 72..229 6..164 250 36.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:50:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24043-PA 165 GH24043-PA 1..165 1..166 709 81.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:57:52
Subject Length Description Subject Range Query Range Score Percent Strand
dod-PA 166 CG17051-PA 1..166 1..166 871 100 Plus
CG32845-PA 386 CG32845-PA 72..235 6..164 244 37.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:50:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15719-PA 164 GI15719-PA 1..164 1..166 747 83.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:50:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14862-PA 163 GL14862-PA 1..163 1..166 741 84.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:50:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14299-PA 163 GA14299-PA 1..163 1..166 741 84.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:50:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23077-PA 166 GM23077-PA 1..166 1..166 787 95.8 Plus
Dsec\GM14286-PA 374 GM14286-PA 74..239 6..164 266 36.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:50:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17528-PA 166 GD17528-PA 1..166 1..166 851 95.2 Plus
Dsim\GD25716-PA 374 GD25716-PA 74..239 6..164 265 36.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:50:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15247-PA 165 GJ15247-PA 1..165 1..166 745 83.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:50:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10078-PA 167 GK10078-PA 1..167 1..166 735 83.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:50:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17920-PA 169 GE17920-PA 1..169 1..166 787 89.3 Plus
Dyak\GE21032-PA 370 GE21032-PA 71..228 6..164 241 35.3 Plus

SD16185.hyp Sequence

Translation from 43 to 543

> SD16185.hyp
MPDAEQLPDGWEKRTSRSTGMSYYLNMYTKESQWDQPTEPAKKAGGGSAG
GGDAPDEVHCLHLLVKHKGSRRPSSWREANITRTKEEAQLLLEVYRNKIV
QQEATFDELARSYSDCSSAKRGGDLGKFGRGQMQAAFEDAAFKLNVNQLS
GIVDSDSGLHIILRKA*

SD16185.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:39:41
Subject Length Description Subject Range Query Range Score Percent Strand
dod-PA 166 CG17051-PA 1..166 1..166 871 100 Plus
CG32845-PA 386 CG32845-PA 72..235 6..164 244 37.8 Plus