Clone SD16673 Report

Search the DGRC for SD16673

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:166
Well:73
Vector:pOT2
Associated Gene/TranscriptCG3621-RA
Protein status:SD16673.pep: gold
Sequenced Size:525

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3621 2008-12-18 5.12 accounting

Clone Sequence Records

SD16673.complete Sequence

525 bp assembled on 2008-12-16

GenBank Submission: BT056316.1

> SD16673.complete
ACGACAGGGCTGGACCTCACAAATAAATATAAAACCAAAATATTCAGTGG
TTTCTCAATTTGAAGAATAATACAAACGGAAAATGTCTGCCCTGCGCCGT
GATGTGTCGCCTTTAATCCAGCGCATTCGGGCCTTCCTCCTGGGTCGGGA
GCACAACCTGGCCCTGCGCTTCGAGGACGGACTGGCCGATCGCACCCAGC
CACAGCCGGAAATCCCTGACGGTCCATCGCATCTACTCTCGGCCAACTAC
TACTGCCAGCGGGATGGACGTCGCGAGGTTCTGCCGCCCATCGACCTGGT
GGAGCAGCAGAAGCAGCTGGCGGCAGAGGGGGAAGCGGCGAAGGCCCCGT
CTTCCAAGCTGCCCACTCCCGGCAAGGTCTATGCCTGGGATTAATGGGCC
GCATCACCGCGGGAATCGCCTTTTTTTGAGTTGTAGTACGAGCCGGTTAA
AGCTAATATAGAATCAAATTGAAGCAGAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAA

SD16673.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:21:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG3621-RA 895 CG3621-RA 124..603 1..480 2400 100 Plus
nc_21543.a 424 nc_21543.a 1..424 19..444 2075 99.5 Plus
CG3621-RA 895 CG3621-RA 705..761 421..477 285 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:51:07
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 2066737..2067068 146..477 1660 100 Plus
chrX 22417052 chrX 2066492..2066636 1..145 725 100 Plus
chrX 22417052 chrX 2067173..2067229 421..477 285 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:56:14 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:51:05
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 2172806..2173140 146..480 1675 100 Plus
X 23542271 X 2172561..2172705 1..145 725 100 Plus
X 23542271 X 2173242..2173298 421..477 285 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:05:24
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 2180904..2181238 146..480 1675 100 Plus
X 23527363 X 2180659..2180803 1..145 725 100 Plus
X 23527363 X 2181340..2181396 421..477 285 100 Plus
Blast to na_te.dros performed 2019-03-15 14:51:06
Subject Length Description Subject Range Query Range Score Percent Strand
TAHRE 10463 TAHRE OSV 10463bp 7872..7933 21..81 118 67.7 Plus

SD16673.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:52:10 Download gff for SD16673.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 2066492..2066636 1..145 100 -> Plus
chrX 2066737..2067068 146..477 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:04:17 Download gff for SD16673.complete
Subject Subject Range Query Range Percent Splice Strand
CG3621-RA 1..312 83..394 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:45:04 Download gff for SD16673.complete
Subject Subject Range Query Range Percent Splice Strand
CG3621-RA 1..312 83..394 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:46:07 Download gff for SD16673.complete
Subject Subject Range Query Range Percent Splice Strand
CG3621-RA 1..312 83..394 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:11:56 Download gff for SD16673.complete
Subject Subject Range Query Range Percent Splice Strand
CG3621-RA 1..312 83..394 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-12-16 12:46:17 Download gff for SD16673.complete
Subject Subject Range Query Range Percent Splice Strand
CG3621-RA 35..511 1..477 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:45:04 Download gff for SD16673.complete
Subject Subject Range Query Range Percent Splice Strand
CG3621-RA 34..510 1..477 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:46:07 Download gff for SD16673.complete
Subject Subject Range Query Range Percent Splice Strand
CG3621-RA 36..512 1..477 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:11:56 Download gff for SD16673.complete
Subject Subject Range Query Range Percent Splice Strand
CG3621-RA 36..512 1..477 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:52:10 Download gff for SD16673.complete
Subject Subject Range Query Range Percent Splice Strand
X 2172561..2172705 1..145 100 -> Plus
X 2172806..2173137 146..477 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:52:10 Download gff for SD16673.complete
Subject Subject Range Query Range Percent Splice Strand
X 2172561..2172705 1..145 100 -> Plus
X 2172806..2173137 146..477 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:52:10 Download gff for SD16673.complete
Subject Subject Range Query Range Percent Splice Strand
X 2172561..2172705 1..145 100 -> Plus
X 2172806..2173137 146..477 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:46:07 Download gff for SD16673.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 2066594..2066738 1..145 100 -> Plus
arm_X 2066839..2067170 146..477 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:30:46 Download gff for SD16673.complete
Subject Subject Range Query Range Percent Splice Strand
X 2180904..2181235 146..477 100   Plus
X 2180659..2180803 1..145 100 -> Plus

SD16673.pep Sequence

Translation from 82 to 393

> SD16673.pep
MSALRRDVSPLIQRIRAFLLGREHNLALRFEDGLADRTQPQPEIPDGPSH
LLSANYYCQRDGRREVLPPIDLVEQQKQLAAEGEAAKAPSSKLPTPGKVY
AWD*

SD16673.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:41:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22195-PA 104 GF22195-PA 1..104 1..103 426 82.7 Plus
Dana\GF10983-PA 125 GF10983-PA 8..122 6..103 204 41.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:41:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12912-PA 104 GG12912-PA 1..104 1..103 499 94.2 Plus
Dere\GG16264-PA 145 GG16264-PA 7..142 5..103 192 35.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:41:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17584-PA 108 GH17584-PA 1..108 1..103 404 72.2 Plus
Dgri\GH16701-PA 165 GH16701-PA 1..78 1..78 195 48.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:46:55
Subject Length Description Subject Range Query Range Score Percent Strand
ND-B14.5A-PB 103 CG3621-PB 1..103 1..103 536 100 Plus
ND-B14.5A-PA 103 CG3621-PA 1..103 1..103 536 100 Plus
ND-B14.5AL-PA 145 CG6914-PA 8..142 6..103 215 40 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:41:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15183-PA 103 GI15183-PA 1..103 1..103 416 73.8 Plus
Dmoj\GI11390-PA 156 GI11390-PA 1..75 1..75 170 44 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:41:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13321-PA 101 GL13321-PA 1..101 1..103 425 80.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:41:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17565-PA 101 GA17565-PA 1..101 1..103 425 80.6 Plus
Dpse\GA19953-PA 160 GA19953-PA 4..81 2..79 205 51.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:41:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19202-PA 104 GM19202-PA 1..104 1..103 520 98.1 Plus
Dsec\GM22454-PA 145 GM22454-PA 8..142 6..103 217 38.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:41:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16591-PA 104 GD16591-PA 1..104 1..103 520 98.1 Plus
Dsim\GD15035-PA 145 GD15035-PA 8..142 6..103 213 37.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:41:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17063-PA 103 GJ17063-PA 1..103 1..103 429 75.7 Plus
Dvir\GJ11644-PA 232 GJ11644-PA 61..132 6..77 167 46.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:41:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16034-PA 101 GK16034-PA 1..101 1..103 423 76.7 Plus
Dwil\GK16765-PA 164 GK16765-PA 8..82 6..78 179 50.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:41:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16241-PA 104 GE16241-PA 1..104 1..103 507 95.2 Plus
Dyak\GE22618-PA 145 GE22618-PA 5..142 3..103 193 35.5 Plus

SD16673.hyp Sequence

Translation from 82 to 393

> SD16673.hyp
MSALRRDVSPLIQRIRAFLLGREHNLALRFEDGLADRTQPQPEIPDGPSH
LLSANYYCQRDGRREVLPPIDLVEQQKQLAAEGEAAKAPSSKLPTPGKVY
AWD*

SD16673.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:10:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG3621-PB 103 CG3621-PB 1..103 1..103 536 100 Plus
CG3621-PA 103 CG3621-PA 1..103 1..103 536 100 Plus
CG6914-PA 145 CG6914-PA 8..142 6..103 215 40 Plus