Clone SD16838 Report

Search the DGRC for SD16838

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:168
Well:38
Vector:pOT2
Associated Gene/TranscriptRcd4-RA
Protein status:SD16838.pep: gold
Preliminary Size:741
Sequenced Size:721

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17295 2002-01-01 Sim4 clustering to Release 2
CG17295 2002-05-18 Blastp of sequenced clone
CG17295 2003-01-01 Sim4 clustering to Release 3
CG17295 2008-04-29 Release 5.5 accounting
CG17295 2008-08-15 Release 5.9 accounting
CG17295 2008-12-18 5.12 accounting

Clone Sequence Records

SD16838.complete Sequence

721 bp (721 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119223

> SD16838.complete
CGAATTGAAGTGTACTACCATAATTCTTGCGAGTCTGCTTAAAATGCCTC
ACAAACGTAGGAACCGAGTACATGCGAACCAAAGGAATTTCACAGCGCGA
CGCGTTTCTGTGGCCAAACTGTCGTCTGCACCGCCGAATGTGCTCGTCGA
ATCCTGCAACGGTTCTCATGCGGATAACAGTTCGCCGGACAGTCCGAAAG
CCAAAGAAGGTGCAATGACCAACGGGAAAAACCCGGAGATCAAGTTAGCC
GTGCCCAAATGCAACACCACCGTGCGCAAGCAGAACGAGGCCCATATCAT
ATCCAACATTAAGCTGGATATGAACCTTAATAAGGATTCTAACTTTATCG
CCCCACAGATCACCAAAAAGATGAACTTCGCTCCGAATCGTGTTGTATTC
GGGGTCCTGGTGCCTCTCAATGTCAACGATTCTGTGCTGGTGCCGCACAA
TAGAAAGCCGGATGCCTTAAAGCACACATCGAAAGAATCGGAATCATGCA
AGGCCATAAGCGAGCCCCAGCTAGCCGACTATGCGGAGAAAGTAGATCCC
ATGATAATGGCTGTTAAGGAACCAGTACTCCACTTGGATTGGGAACCAGG
GCCCTTCGATTTTTTCGGCGCATATAGGAGAACATACAACTAGAGTTACA
TTTTATTTATAAATATATCCGAGAATATCAGAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAA

SD16838.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:00:32
Subject Length Description Subject Range Query Range Score Percent Strand
Rcd4-RA 833 Rcd4-RA 153..833 1..681 3345 99.4 Plus
CG13393.a 459 CG13393.a 411..459 683..635 230 97.9 Minus
CG13393-RA 522 CG13393-RA 474..522 683..635 230 97.9 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:59:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8381824..8382181 1..358 1790 100 Plus
chr2L 23010047 chr2L 8382238..8382568 351..681 1580 98.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:56:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:59:24
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8382913..8383270 1..358 1790 100 Plus
2L 23513712 2L 8383327..8383659 351..683 1590 98.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:32:25
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8382913..8383270 1..358 1790 100 Plus
2L 23513712 2L 8383327..8383659 351..683 1590 98.4 Plus
Blast to na_te.dros performed on 2019-03-15 19:59:24 has no hits.

SD16838.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:00:03 Download gff for SD16838.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8381824..8382181 1..358 100 -> Plus
chr2L 8382246..8382568 359..681 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:08:44 Download gff for SD16838.complete
Subject Subject Range Query Range Percent Splice Strand
CG17295-RA 1..600 44..643 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:40:44 Download gff for SD16838.complete
Subject Subject Range Query Range Percent Splice Strand
Rcd4-RB 1..600 44..643 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:17:29 Download gff for SD16838.complete
Subject Subject Range Query Range Percent Splice Strand
Rcd4-RA 1..600 44..643 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:32:39 Download gff for SD16838.complete
Subject Subject Range Query Range Percent Splice Strand
CG17295-RA 1..600 44..643 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:12:13 Download gff for SD16838.complete
Subject Subject Range Query Range Percent Splice Strand
Rcd4-RA 1..600 44..643 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:14:29 Download gff for SD16838.complete
Subject Subject Range Query Range Percent Splice Strand
CG17295-RA 99..779 1..681 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:40:44 Download gff for SD16838.complete
Subject Subject Range Query Range Percent Splice Strand
Rcd4-RB 1..681 1..681 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:17:29 Download gff for SD16838.complete
Subject Subject Range Query Range Percent Splice Strand
Rcd4-RA 53..733 1..681 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:32:39 Download gff for SD16838.complete
Subject Subject Range Query Range Percent Splice Strand
CG17295-RA 99..779 1..681 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:12:13 Download gff for SD16838.complete
Subject Subject Range Query Range Percent Splice Strand
Rcd4-RA 53..733 1..681 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:00:03 Download gff for SD16838.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8382913..8383270 1..358 100 -> Plus
2L 8383335..8383657 359..681 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:00:03 Download gff for SD16838.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8382913..8383270 1..358 100 -> Plus
2L 8383335..8383657 359..681 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:00:03 Download gff for SD16838.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8382913..8383270 1..358 100 -> Plus
2L 8383335..8383657 359..681 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:17:29 Download gff for SD16838.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8382913..8383270 1..358 100 -> Plus
arm_2L 8383335..8383657 359..681 98   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:05:06 Download gff for SD16838.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8382913..8383270 1..358 100 -> Plus
2L 8383335..8383657 359..681 98   Plus

SD16838.hyp Sequence

Translation from 0 to 642

> SD16838.hyp
ELKCTTIILASLLKMPHKRRNRVHANQRNFTARRVSVAKLSSAPPNVLVE
SCNGSHADNSSPDSPKAKEGAMTNGKNPEIKLAVPKCNTTVRKQNEAHII
SNIKLDMNLNKDSNFIAPQITKKMNFAPNRVVFGVLVPLNVNDSVLVPHN
RKPDALKHTSKESESCKAISEPQLADYAEKVDPMIMAVKEPVLHLDWEPG
PFDFFGAYRRTYN*

SD16838.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:51:08
Subject Length Description Subject Range Query Range Score Percent Strand
Rcd4-PB 199 CG17295-PB 1..199 15..213 1048 100 Plus
Rcd4-PA 199 CG17295-PA 1..199 15..213 1048 100 Plus

SD16838.pep Sequence

Translation from 43 to 642

> SD16838.pep
MPHKRRNRVHANQRNFTARRVSVAKLSSAPPNVLVESCNGSHADNSSPDS
PKAKEGAMTNGKNPEIKLAVPKCNTTVRKQNEAHIISNIKLDMNLNKDSN
FIAPQITKKMNFAPNRVVFGVLVPLNVNDSVLVPHNRKPDALKHTSKESE
SCKAISEPQLADYAEKVDPMIMAVKEPVLHLDWEPGPFDFFGAYRRTYN*

SD16838.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:19:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15225-PA 203 GF15225-PA 1..202 1..198 330 42.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:19:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10545-PA 202 GG10545-PA 1..202 1..199 623 67.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 04:19:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10378-PA 198 GH10378-PA 1..194 1..196 237 33 Plus
Dgri\GH23641-PA 199 GH23641-PA 1..195 1..196 233 32.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:38
Subject Length Description Subject Range Query Range Score Percent Strand
Rcd4-PB 199 CG17295-PB 1..199 1..199 1048 100 Plus
Rcd4-PA 199 CG17295-PA 1..199 1..199 1048 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 04:19:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17356-PA 196 GI17356-PA 1..193 1..198 283 34.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:19:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25940-PA 167 GL25940-PA 37..166 68..198 230 40.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:19:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14447-PA 167 GA14447-PA 37..166 68..198 229 40.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:19:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16924-PA 199 GM16924-PA 1..199 1..199 927 87.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:19:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23534-PA 199 GD23534-PA 1..199 1..199 920 86.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:19:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18030-PA 194 GJ18030-PA 1..191 1..198 274 35.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:19:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24163-PA 211 GK24163-PA 1..207 1..198 295 36.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:19:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18765-PA 202 GE18765-PA 1..202 1..199 692 69.3 Plus