BDGP Sequence Production Resources |
Search the DGRC for SD16838
Library: | SD |
Tissue Source: | Drosophila melanogaster Schneider L2 cell culture |
Created by: | Ling Hong |
Date Registered: | 1999-02-25 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 168 |
Well: | 38 |
Vector: | pOT2 |
Associated Gene/Transcript | Rcd4-RA |
Protein status: | SD16838.pep: gold |
Preliminary Size: | 741 |
Sequenced Size: | 721 |
Gene | Date | Evidence |
---|---|---|
CG17295 | 2002-01-01 | Sim4 clustering to Release 2 |
CG17295 | 2002-05-18 | Blastp of sequenced clone |
CG17295 | 2003-01-01 | Sim4 clustering to Release 3 |
CG17295 | 2008-04-29 | Release 5.5 accounting |
CG17295 | 2008-08-15 | Release 5.9 accounting |
CG17295 | 2008-12-18 | 5.12 accounting |
721 bp (721 high quality bases) assembled on 2002-05-18
GenBank Submission: AY119223
> SD16838.complete CGAATTGAAGTGTACTACCATAATTCTTGCGAGTCTGCTTAAAATGCCTC ACAAACGTAGGAACCGAGTACATGCGAACCAAAGGAATTTCACAGCGCGA CGCGTTTCTGTGGCCAAACTGTCGTCTGCACCGCCGAATGTGCTCGTCGA ATCCTGCAACGGTTCTCATGCGGATAACAGTTCGCCGGACAGTCCGAAAG CCAAAGAAGGTGCAATGACCAACGGGAAAAACCCGGAGATCAAGTTAGCC GTGCCCAAATGCAACACCACCGTGCGCAAGCAGAACGAGGCCCATATCAT ATCCAACATTAAGCTGGATATGAACCTTAATAAGGATTCTAACTTTATCG CCCCACAGATCACCAAAAAGATGAACTTCGCTCCGAATCGTGTTGTATTC GGGGTCCTGGTGCCTCTCAATGTCAACGATTCTGTGCTGGTGCCGCACAA TAGAAAGCCGGATGCCTTAAAGCACACATCGAAAGAATCGGAATCATGCA AGGCCATAAGCGAGCCCCAGCTAGCCGACTATGCGGAGAAAGTAGATCCC ATGATAATGGCTGTTAAGGAACCAGTACTCCACTTGGATTGGGAACCAGG GCCCTTCGATTTTTTCGGCGCATATAGGAGAACATACAACTAGAGTTACA TTTTATTTATAAATATATCCGAGAATATCAGAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 8381824..8382181 | 1..358 | 100 | -> | Plus |
chr2L | 8382246..8382568 | 359..681 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17295-RA | 1..600 | 44..643 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rcd4-RB | 1..600 | 44..643 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rcd4-RA | 1..600 | 44..643 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17295-RA | 1..600 | 44..643 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rcd4-RA | 1..600 | 44..643 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17295-RA | 99..779 | 1..681 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rcd4-RB | 1..681 | 1..681 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rcd4-RA | 53..733 | 1..681 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17295-RA | 99..779 | 1..681 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rcd4-RA | 53..733 | 1..681 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 8382913..8383270 | 1..358 | 100 | -> | Plus |
2L | 8383335..8383657 | 359..681 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 8382913..8383270 | 1..358 | 100 | -> | Plus |
2L | 8383335..8383657 | 359..681 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 8382913..8383270 | 1..358 | 100 | -> | Plus |
2L | 8383335..8383657 | 359..681 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 8382913..8383270 | 1..358 | 100 | -> | Plus |
arm_2L | 8383335..8383657 | 359..681 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 8382913..8383270 | 1..358 | 100 | -> | Plus |
2L | 8383335..8383657 | 359..681 | 98 | Plus |
Translation from 0 to 642
> SD16838.hyp ELKCTTIILASLLKMPHKRRNRVHANQRNFTARRVSVAKLSSAPPNVLVE SCNGSHADNSSPDSPKAKEGAMTNGKNPEIKLAVPKCNTTVRKQNEAHII SNIKLDMNLNKDSNFIAPQITKKMNFAPNRVVFGVLVPLNVNDSVLVPHN RKPDALKHTSKESESCKAISEPQLADYAEKVDPMIMAVKEPVLHLDWEPG PFDFFGAYRRTYN*
Translation from 43 to 642
> SD16838.pep MPHKRRNRVHANQRNFTARRVSVAKLSSAPPNVLVESCNGSHADNSSPDS PKAKEGAMTNGKNPEIKLAVPKCNTTVRKQNEAHIISNIKLDMNLNKDSN FIAPQITKKMNFAPNRVVFGVLVPLNVNDSVLVPHNRKPDALKHTSKESE SCKAISEPQLADYAEKVDPMIMAVKEPVLHLDWEPGPFDFFGAYRRTYN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF15225-PA | 203 | GF15225-PA | 1..202 | 1..198 | 330 | 42.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG10545-PA | 202 | GG10545-PA | 1..202 | 1..199 | 623 | 67.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH10378-PA | 198 | GH10378-PA | 1..194 | 1..196 | 237 | 33 | Plus |
Dgri\GH23641-PA | 199 | GH23641-PA | 1..195 | 1..196 | 233 | 32.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Rcd4-PB | 199 | CG17295-PB | 1..199 | 1..199 | 1048 | 100 | Plus |
Rcd4-PA | 199 | CG17295-PA | 1..199 | 1..199 | 1048 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI17356-PA | 196 | GI17356-PA | 1..193 | 1..198 | 283 | 34.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL25940-PA | 167 | GL25940-PA | 37..166 | 68..198 | 230 | 40.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA14447-PA | 167 | GA14447-PA | 37..166 | 68..198 | 229 | 40.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM16924-PA | 199 | GM16924-PA | 1..199 | 1..199 | 927 | 87.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23534-PA | 199 | GD23534-PA | 1..199 | 1..199 | 920 | 86.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ18030-PA | 194 | GJ18030-PA | 1..191 | 1..198 | 274 | 35.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK24163-PA | 211 | GK24163-PA | 1..207 | 1..198 | 295 | 36.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE18765-PA | 202 | GE18765-PA | 1..202 | 1..199 | 692 | 69.3 | Plus |