Clone SD16985 Report

Search the DGRC for SD16985

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:169
Well:85
Vector:pOT2
Associated Gene/TranscriptEndoGI-RA
Protein status:SD16985.pep: gold
Preliminary Size:1154
Sequenced Size:1390

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4930 2002-01-01 Sim4 clustering to Release 2
CG4930 2002-05-18 Blastp of sequenced clone
CG4930 2003-01-01 Sim4 clustering to Release 3
CG4930 2008-04-29 Release 5.5 accounting
CG4930 2008-08-15 Release 5.9 accounting
CG4930 2008-12-18 5.12 accounting

Clone Sequence Records

SD16985.complete Sequence

1390 bp (1390 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119226

> SD16985.complete
AGCAAGCGGCGATCTGAATTAGTCATCTTATCTCTTTCCGACAGAAGTGA
CGATCAATAGCCCAACGATTTTAAACGCTTTACTTCGAAGAACCTTAAAT
CGCCAATTTATCCAGAGGGGCATGTCCAAGCGCAAGGCCGAGGACACACA
ATCCGACAAAATGGCAACGGCCGAGAAAGTAGCACAGAACGATTACACCA
TTGGCCTGGTGGATCCCGTTAAGGATTACCAAAAGCTTATCGAAACACGC
GTGCAGGTAGACGAAATCGTGGATGATGATGTCACCAAGGAGAATTTCGA
TCGAACGGCTGCAGCGGCGCGTGACGTCATCTGGCGGCTGTTATTCGACG
AGGCCGGTACCTCGCAATCGAACACAGAGAAGGCCAGCCAATTGCTGGAG
GAATACCGTGGTGACGCCTGCTTCTACGACCCGACGCCGTACAACGAATG
GATTGTCAAGCTGAGGGATGAGGTTCTAAAGAAGGAACTCCTCGACTTTT
GGCGCGATGTGCTGGTGAAGAAGCAACTCGGTCCCTGTTGGTCACGCGAC
AGTGATCTCTTTGACAGCGACGACACCCCGCCATTGGAGTTCTATGCCCA
TGCCGGTTGTACCGCTCCATTTGCAGCCAGCTTAAAGGTGCGCGCAGCAC
TCGAGGAGCAGGCTTCGCTGGATCAGGATGGGCCAGCGACGCCTACAACT
CCGGGTGAACTGAGTGCCGATGATGCCGCCGCTCTGTCTGGCGAATTTGA
GGCCACCCTGACCAAGGAAAATCCGCTCGAGGAATACCGAACTCTAATGA
AGCGCTTTGTTCTGACCAAAATCATCGTTCCGGACAGCGTTCACCAGGCC
AGCGTGAAGAAGATAGCGGCAGCCGCCAGGGAGATAATCTGGAAGCTGCT
CTTCGATGGCACACCCTCAGCGGAGGATCAAAACAAGGCCGCCGAGCTGC
TGCAGGAGTACAAGGGTGATGCTGGTTTCTATGGGCCCGACGACTACAAC
AGTTGGATTTTCAATCTGAGGGATGAGGTTCTCACCAAAGAGCTTCTCGA
CTTTTGGCGCGACAAGATGGTGAAAATGGAACTTGGTCCCAGTTGCGCCC
GCGATTCCGACTATTACGACAACGAGGATCCGCTGCCATTCGAGTTTTAC
GAAAAGGCTGGTTGCAAGGCTCCCTTTGAAGGACCTGTAAATGATGATTA
GTAGTGCATCTTTCATGACTGAAGGATTGTTTCCTTATGTACTAAAACAC
CTATTCTGGTCGTAATCTCTGAAGGCACACACAGTAAAGCATTTCAATAT
CTGAATTATGTTTCGAAATGTTAGAAATTGTTTAAAAATGAATAAAATGA
TAAGTATTTTATAACTGTTCTCAAAAAAAAAAAAAAAAAA

SD16985.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:00:21
Subject Length Description Subject Range Query Range Score Percent Strand
EndoGI-RA 1535 EndoGI-RA 126..1502 1..1377 6870 99.9 Plus
EndoGI.a 1397 EndoGI.a 70..1397 45..1372 6625 99.9 Plus
EndoGI.b 1403 EndoGI.b 79..1403 48..1372 6610 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:12:09
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 16257101..16258289 184..1372 5945 100 Plus
chr2L 23010047 chr2L 16256849..16257035 1..187 920 99.5 Plus
chr2L 23010047 chr2L 16257366..16257457 1004..1095 205 81.5 Plus
chr2L 23010047 chr2L 16257921..16258012 449..540 205 81.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:56:23 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:12:07
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16258245..16259438 184..1377 5970 100 Plus
2L 23513712 2L 16257993..16258179 1..187 920 99.5 Plus
2L 23513712 2L 16258510..16258601 1004..1095 205 81.5 Plus
2L 23513712 2L 16259065..16259156 449..540 205 81.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:32:18
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16258245..16259438 184..1377 5970 100 Plus
2L 23513712 2L 16257993..16258179 1..187 920 99.4 Plus
Blast to na_te.dros performed 2019-03-16 15:12:08
Subject Length Description Subject Range Query Range Score Percent Strand
rooA 7621 rooA ROOA_LTR 7621bp 243..306 1292..1354 119 67.2 Plus
rooA 7621 rooA ROOA_LTR 7621bp 7478..7541 1292..1354 119 67.2 Plus

SD16985.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:12:46 Download gff for SD16985.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 16256849..16257035 1..187 99 -> Plus
chr2L 16257105..16258289 188..1372 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:08:48 Download gff for SD16985.complete
Subject Subject Range Query Range Percent Splice Strand
CG4930-RA 1..1080 122..1201 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:40:32 Download gff for SD16985.complete
Subject Subject Range Query Range Percent Splice Strand
EndoGI-RA 1..1080 122..1201 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:06:41 Download gff for SD16985.complete
Subject Subject Range Query Range Percent Splice Strand
EndoGI-RA 1..1080 122..1201 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:32:26 Download gff for SD16985.complete
Subject Subject Range Query Range Percent Splice Strand
CG4930-RA 1..1080 122..1201 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:38:14 Download gff for SD16985.complete
Subject Subject Range Query Range Percent Splice Strand
EndoGI-RA 1..1080 122..1201 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:14:09 Download gff for SD16985.complete
Subject Subject Range Query Range Percent Splice Strand
CG4930-RA 1..1372 1..1372 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:40:31 Download gff for SD16985.complete
Subject Subject Range Query Range Percent Splice Strand
EndoGI-RA 1..1372 1..1372 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:06:41 Download gff for SD16985.complete
Subject Subject Range Query Range Percent Splice Strand
EndoGI-RA 1..1360 13..1372 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:32:27 Download gff for SD16985.complete
Subject Subject Range Query Range Percent Splice Strand
CG4930-RA 1..1372 1..1372 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:38:14 Download gff for SD16985.complete
Subject Subject Range Query Range Percent Splice Strand
EndoGI-RA 1..1360 13..1372 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:12:46 Download gff for SD16985.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16257993..16258179 1..187 99 -> Plus
2L 16258249..16259433 188..1372 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:12:46 Download gff for SD16985.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16257993..16258179 1..187 99 -> Plus
2L 16258249..16259433 188..1372 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:12:46 Download gff for SD16985.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16257993..16258179 1..187 99 -> Plus
2L 16258249..16259433 188..1372 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:06:41 Download gff for SD16985.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16257993..16258179 1..187 99 -> Plus
arm_2L 16258249..16259433 188..1372 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:04:52 Download gff for SD16985.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16258249..16259433 188..1372 100   Plus
2L 16257993..16258179 1..187 99 -> Plus

SD16985.pep Sequence

Translation from 121 to 1200

> SD16985.pep
MSKRKAEDTQSDKMATAEKVAQNDYTIGLVDPVKDYQKLIETRVQVDEIV
DDDVTKENFDRTAAAARDVIWRLLFDEAGTSQSNTEKASQLLEEYRGDAC
FYDPTPYNEWIVKLRDEVLKKELLDFWRDVLVKKQLGPCWSRDSDLFDSD
DTPPLEFYAHAGCTAPFAASLKVRAALEEQASLDQDGPATPTTPGELSAD
DAAALSGEFEATLTKENPLEEYRTLMKRFVLTKIIVPDSVHQASVKKIAA
AAREIIWKLLFDGTPSAEDQNKAAELLQEYKGDAGFYGPDDYNSWIFNLR
DEVLTKELLDFWRDKMVKMELGPSCARDSDYYDNEDPLPFEFYEKAGCKA
PFEGPVNDD*

SD16985.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:17:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14961-PA 358 GF14961-PA 1..358 1..358 1361 73.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:17:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25195-PA 360 GG25195-PA 1..359 1..359 1779 93.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 04:17:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13511-PA 362 GH13511-PA 1..361 1..358 1112 58.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:54:53
Subject Length Description Subject Range Query Range Score Percent Strand
EndoGI-PC 359 CG4930-PC 1..359 1..359 1890 100 Plus
EndoGI-PB 359 CG4930-PB 1..359 1..359 1890 100 Plus
EndoGI-PA 359 CG4930-PA 1..359 1..359 1890 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 04:17:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10268-PA 343 GI10268-PA 14..343 22..355 1082 64.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:17:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25983-PA 370 GL25983-PA 1..369 1..357 1245 64.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:17:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18533-PA 370 GA18533-PA 1..369 1..357 1245 64.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:17:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18658-PA 336 GM18658-PA 1..336 1..359 1692 91.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:17:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24044-PA 359 GD24044-PA 1..359 1..359 1846 97.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:17:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18019-PA 346 GJ18019-PA 14..344 21..355 1055 60 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:17:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18285-PA 518 GK18285-PA 173..516 13..359 1066 59.2 Plus
Dwil\GK18285-PA 518 GK18285-PA 1..327 1..352 897 51.3 Plus
Dwil\GK18285-PA 518 GK18285-PA 344..512 7..170 332 44.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:17:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21376-PA 358 GE21376-PA 1..358 1..359 1717 91.1 Plus

SD16985.hyp Sequence

Translation from 121 to 1200

> SD16985.hyp
MSKRKAEDTQSDKMATAEKVAQNDYTIGLVDPVKDYQKLIETRVQVDEIV
DDDVTKENFDRTAAAARDVIWRLLFDEAGTSQSNTEKASQLLEEYRGDAC
FYDPTPYNEWIVKLRDEVLKKELLDFWRDVLVKKQLGPCWSRDSDLFDSD
DTPPLEFYAHAGCTAPFAASLKVRAALEEQASLDQDGPATPTTPGELSAD
DAAALSGEFEATLTKENPLEEYRTLMKRFVLTKIIVPDSVHQASVKKIAA
AAREIIWKLLFDGTPSAEDQNKAAELLQEYKGDAGFYGPDDYNSWIFNLR
DEVLTKELLDFWRDKMVKMELGPSCARDSDYYDNEDPLPFEFYEKAGCKA
PFEGPVNDD*

SD16985.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:18:16
Subject Length Description Subject Range Query Range Score Percent Strand
EndoGI-PC 359 CG4930-PC 1..359 1..359 1890 100 Plus
EndoGI-PB 359 CG4930-PB 1..359 1..359 1890 100 Plus
EndoGI-PA 359 CG4930-PA 1..359 1..359 1890 100 Plus