Clone SD17342 Report

Search the DGRC for SD17342

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:173
Well:42
Vector:pOT2
Associated Gene/TranscriptCG12341-RA
Protein status:SD17342.pep: gold
Preliminary Size:506
Sequenced Size:1145

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12341 2002-01-01 Sim4 clustering to Release 2
CG12341 2002-05-18 Blastp of sequenced clone
CG12341 2003-01-01 Sim4 clustering to Release 3
CG12341 2008-04-29 Release 5.5 accounting
CG12341 2008-08-15 Release 5.9 accounting
CG12341 2008-12-18 5.12 accounting

Clone Sequence Records

SD17342.complete Sequence

1145 bp (1145 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119227

> SD17342.complete
CCCAATCCCAAACGTTCCATTCCCATTGCCATAGTAAATCGCAGACAAGA
ACAATATAAAATTAAATTAAACCAACTAAAAGTGTTTGGTGTTGCTCAAA
ATGTGGAGTTAGGGCTGCCGCACACCAGTAGCCTGGTAATTAGGCCCGAT
TTAGCATTCACTGCCGCCAGCCGAGCGCTAATTGAGTGCCGTGACGAAAG
TTCAATCGATTGTTGACCGAATTAAAAATAAGCCAAACATTTGCTAAACT
ACAGTGCTAACCGGAAGTTAAGGCCATGCTAAATAGGATCAAGCAACTGA
AAAAGACTGCAATCCAAATCCGGCTATAGAATACGACAAATGTGGTGTGG
GTGTGGCCAATAGCACACACATGTGTTGGCGTCCATGAATATTGGCTGGA
TACATGCTATAGAAAGGGAATCCCCACCAGACATGCGGCTGGACACTCAA
CTGACCAACGGAAAAGCAATAACTAGCAACTAGTAACTAGGGATACCACG
TCAACATCCATCGACTACGTTTTAGCCATGTTCTCGGACGACACCGATGA
GTTGGACACCATCGCCGATGTGATGGGACTCCGGTCACAGGCGCGTCTCA
ATACGTTTCGCGAAATGTGGTACCACGTCTTTCTGTGGGCCCTGTTCTCC
TCCATATTCATTCACACCTGCGCCGCCGTGGTGGCCTTCTTCACGCTCCG
GAAGCACAAGTTCGGACGATTCTTCTCGATCCTCATCCTTGTCATGGGAT
TCCTTTCCCCGGCCTCCAGTGGCATCATCAGCAGTGCAGTCATCGCCTTT
GTGCATCGTGCCTCCAGTCTGCCCATGTCGCCCATATACGCCATGATCTG
GGGCCTCGGCCAGACCATCGTCTCCGCCTGCCTGGGATTCACCCGGATTC
TGGCCACGCTATAGAGCACGGACTGAAGTTTTTCATCGGCCATGGCCAAC
ACTCCATTCTCCACATCGCGCCCAATCCAATGTTCACAGAGTTCCGACTT
CCAAGCGGACATATTATCAATTCTTCAGGTGTGCAAACCACAATTAATTG
AATTCATAGTTATGTGTATAGGAACATTGTGATTTTTAAAATTATACCTT
ATACGATGAGAAAATAATGTAAAAAAAAAAAAAAAAAAAAAAAAA

SD17342.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:00:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG12341-RA 1247 CG12341-RA 51..1174 1..1124 5545 99.5 Plus
mms4-RA 1131 mms4-RA 1060..1131 1124..1053 360 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:08:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 6699694..6700433 1120..381 3670 99.7 Minus
chr2R 21145070 chr2R 6700486..6700867 382..1 1910 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:56:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:08:52
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10812153..10812896 1124..381 3675 99.6 Minus
2R 25286936 2R 10812949..10813330 382..1 1880 99.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:32:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 10813352..10814095 1124..381 3675 99.5 Minus
2R 25260384 2R 10814148..10814529 382..1 1880 99.4 Minus
Blast to na_te.dros performed on 2019-03-15 23:08:52 has no hits.

SD17342.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:09:51 Download gff for SD17342.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 6699694..6700433 381..1120 99 <- Minus
chr2R 6700488..6700867 1..380 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:08:52 Download gff for SD17342.complete
Subject Subject Range Query Range Percent Splice Strand
CG12341-RA 1..387 528..914 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:40:33 Download gff for SD17342.complete
Subject Subject Range Query Range Percent Splice Strand
CG12341-RA 1..387 528..914 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:29:20 Download gff for SD17342.complete
Subject Subject Range Query Range Percent Splice Strand
CG12341-RA 1..387 528..914 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:32:28 Download gff for SD17342.complete
Subject Subject Range Query Range Percent Splice Strand
CG12341-RA 1..387 528..914 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:20:53 Download gff for SD17342.complete
Subject Subject Range Query Range Percent Splice Strand
CG12341-RA 1..387 528..914 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:14:11 Download gff for SD17342.complete
Subject Subject Range Query Range Percent Splice Strand
CG12341-RA 1..1120 1..1120 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:40:33 Download gff for SD17342.complete
Subject Subject Range Query Range Percent Splice Strand
CG12341-RA 1..1120 1..1120 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:29:20 Download gff for SD17342.complete
Subject Subject Range Query Range Percent Splice Strand
CG12341-RA 1..1100 21..1120 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:32:28 Download gff for SD17342.complete
Subject Subject Range Query Range Percent Splice Strand
CG12341-RA 1..1120 1..1120 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:20:53 Download gff for SD17342.complete
Subject Subject Range Query Range Percent Splice Strand
CG12341-RA 1..1100 21..1120 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:09:51 Download gff for SD17342.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10812157..10812896 381..1120 99 <- Minus
2R 10812951..10813330 1..380 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:09:51 Download gff for SD17342.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10812157..10812896 381..1120 99 <- Minus
2R 10812951..10813330 1..380 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:09:51 Download gff for SD17342.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10812157..10812896 381..1120 99 <- Minus
2R 10812951..10813330 1..380 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:29:20 Download gff for SD17342.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6700456..6700835 1..380 99   Minus
arm_2R 6699662..6700401 381..1120 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:04:54 Download gff for SD17342.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10813356..10814095 381..1120 99 <- Minus
2R 10814150..10814529 1..380 99   Minus

SD17342.pep Sequence

Translation from 527 to 913

> SD17342.pep
MFSDDTDELDTIADVMGLRSQARLNTFREMWYHVFLWALFSSIFIHTCAA
VVAFFTLRKHKFGRFFSILILVMGFLSPASSGIISSAVIAFVHRASSLPM
SPIYAMIWGLGQTIVSACLGFTRILATL*

SD17342.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:17:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11085-PA 131 GF11085-PA 7..131 4..128 639 98.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:17:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22718-PA 128 GG22718-PA 1..128 1..128 659 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 04:17:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22550-PA 130 GH22550-PA 1..130 1..128 571 86.2 Plus
Dgri\GH20610-PA 130 GH20610-PA 1..130 1..128 571 86.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:16:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG12341-PA 128 CG12341-PA 1..128 1..128 653 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 04:17:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19166-PA 130 GI19166-PA 1..130 1..128 572 85.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:17:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17178-PA 130 GL17178-PA 1..130 1..128 629 94.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:17:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11566-PA 130 GA11566-PA 1..130 1..128 629 94.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:17:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20493-PA 128 GM20493-PA 1..128 1..128 659 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:17:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25956-PA 128 GD25956-PA 1..128 1..128 659 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:17:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20124-PA 130 GJ20124-PA 1..130 1..128 580 86.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:17:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19334-PA 128 GK19334-PA 1..128 1..128 634 94.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:17:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13074-PA 128 GE13074-PA 1..128 1..128 659 100 Plus

SD17342.hyp Sequence

Translation from 527 to 913

> SD17342.hyp
MFSDDTDELDTIADVMGLRSQARLNTFREMWYHVFLWALFSSIFIHTCAA
VVAFFTLRKHKFGRFFSILILVMGFLSPASSGIISSAVIAFVHRASSLPM
SPIYAMIWGLGQTIVSACLGFTRILATL*

SD17342.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:46:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG12341-PA 128 CG12341-PA 1..128 1..128 653 100 Plus