Clone SD17447 Report

Search the DGRC for SD17447

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:174
Well:47
Vector:pOT2
Associated Gene/TranscriptCG33331-RA
Protein status:SD17447.pep: gold
Sequenced Size:1270

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG33331 2004-01-13 Blastp of sequenced clone
CG33331 2008-04-29 Release 5.5 accounting
CG33331 2008-08-15 Release 5.9 accounting
CG33331 2008-12-18 5.12 accounting

Clone Sequence Records

SD17447.complete Sequence

1270 bp (1270 high quality bases) assembled on 2004-01-13

GenBank Submission: BT011333

> SD17447.complete
TCCATCCAGAAGAAGTGGAGTTACGTGCTAAAAAAAAAGTAATTATAAAG
CCTAAGTTTAGTCCAATTAGGAGGTAAAACACGCACAAGATGCTGGACCT
ATACAGACGCACGGTGGCGCGGTTTCCTCTGGGCAGTGTCAGCTATATGT
TCGCCTACGGATCCGGCGTCAAACAGCAGGAAGGCTATGGAAAAGTCGGC
AATGGAAACAACCTGCGTCCTCCGCCGGGAACCGTTGTGGATCTGGTCTT
TTGCGTTCGTGATGCTAGGGGCTTCCATGCGGAGAACCTGCACCGTCATC
CGGACCACTATTCCGCCCTTAGGCACCTGGGACCGAACTTTGTGGCCAAG
TATCAGGAGCGTTTGGGTGCGGGTGTCTATTGCAACACGTTGGTGCCTCT
GCCAGATGTGGGCATTACCATAAAGTACGGCGTGGTGTCGCAGGAGGAGC
TGCTGGAGGATCTGCTTGACTGGCGGCATCTTTACTTGGCAGGAAGGCTG
CACAAACCAGTGACGAATCTGGTCAATCCTTCTGATAATCCTCCCCTCAA
GGCTGCGCTGGAGAGGAATCTTGTATCCGCGCTGCAAGTGGCTCTGCTAC
TTTTACCAGAGAAGTTCACTGCCTACGGACTTTTCCACACCATCGCCGGA
CTGAGTTACAAGGGCGATTTCCGTATGATTTTCGGGGAAAACAAACAGAA
AGTGCACAACATAGTTAGTCCGCAAATCAATGACTTCTTCGCCCTATACC
AACCCTCCCTGGGACAACTTTCCGACTATGTGGCGGTAAACATGAAGGGC
CAGGAACCAGGGAGCCGGAAACCAGCCATAATCTTCGAGCAGGACAAATC
CTCATCGGCTACATGCCAACACCTGCGACAGTTGCCCCGAGAGCTTCAGA
AGCGATTGCAGCGAAATGCCGCCTGTCGTGGCGACTACACCCAGGTGGTG
AATCACCTATCCATGGCCTCCCAGCTTCCGGAGGTGCTGCAGGCATCCGT
CAACGACATTGTGTGGCGCAGCAGTGTCACGCAATCGATCAAAAATATTC
CCAGTGCTGGCATTCTCAAGTCATTGGCGTATAGCTATCGCAAGGCTCAA
AAGACATTCGCTGTTTAGGTTTATTTTTCGGGTTAATCCCCTGGCTGCCA
ATCATTCTACCGACTAAGTTGTCCCATCCAGCTGCATTTTGTTAAATACT
TTTAAGCTTTAAAGTTGTTAACTGCAATATAATGTTTAGCCCAATCCAAA
AAAAAAAAAAAAAAAAAAAA

SD17447.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:09:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG33331-RA 1264 CG33331-RA 18..1264 1..1247 6235 100 Plus
CG33332-RA 1294 CG33332-RA 14..51 1..38 190 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:14:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 10711138..10712384 1..1247 6160 99.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:56:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:14:46
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 14886493..14887742 1..1250 6250 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:53:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 14627324..14628573 1..1250 6250 100 Plus
Blast to na_te.dros performed on 2019-03-16 15:14:47 has no hits.

SD17447.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:15:59 Download gff for SD17447.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 10711138..10712384 1..1247 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:08:54 Download gff for SD17447.complete
Subject Subject Range Query Range Percent Splice Strand
CG33331-RA 1..1029 90..1118 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:42:29 Download gff for SD17447.complete
Subject Subject Range Query Range Percent Splice Strand
CG33331-RA 1..1029 90..1118 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:06:47 Download gff for SD17447.complete
Subject Subject Range Query Range Percent Splice Strand
CG33331-RA 1..1029 90..1118 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:31:19 Download gff for SD17447.complete
Subject Subject Range Query Range Percent Splice Strand
CG33331-RA 1..1029 90..1118 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:38:20 Download gff for SD17447.complete
Subject Subject Range Query Range Percent Splice Strand
CG33331-RA 1..1029 90..1118 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:52:14 Download gff for SD17447.complete
Subject Subject Range Query Range Percent Splice Strand
CG33331-RA 18..1135 1..1118 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:42:28 Download gff for SD17447.complete
Subject Subject Range Query Range Percent Splice Strand
CG33331-RA 18..1264 1..1247 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:06:47 Download gff for SD17447.complete
Subject Subject Range Query Range Percent Splice Strand
CG33331-RA 18..1264 1..1247 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:31:19 Download gff for SD17447.complete
Subject Subject Range Query Range Percent Splice Strand
CG33331-RA 18..1135 1..1118 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:38:20 Download gff for SD17447.complete
Subject Subject Range Query Range Percent Splice Strand
CG33331-RA 38..1284 1..1247 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:15:59 Download gff for SD17447.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14886493..14887739 1..1247 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:15:59 Download gff for SD17447.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14886493..14887739 1..1247 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:15:59 Download gff for SD17447.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14886493..14887739 1..1247 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:06:47 Download gff for SD17447.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 10712215..10713461 1..1247 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:03:51 Download gff for SD17447.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14627324..14628570 1..1247 100   Plus

SD17447.pep Sequence

Translation from 89 to 1117

> SD17447.pep
MLDLYRRTVARFPLGSVSYMFAYGSGVKQQEGYGKVGNGNNLRPPPGTVV
DLVFCVRDARGFHAENLHRHPDHYSALRHLGPNFVAKYQERLGAGVYCNT
LVPLPDVGITIKYGVVSQEELLEDLLDWRHLYLAGRLHKPVTNLVNPSDN
PPLKAALERNLVSALQVALLLLPEKFTAYGLFHTIAGLSYKGDFRMIFGE
NKQKVHNIVSPQINDFFALYQPSLGQLSDYVAVNMKGQEPGSRKPAIIFE
QDKSSSATCQHLRQLPRELQKRLQRNAACRGDYTQVVNHLSMASQLPEVL
QASVNDIVWRSSVTQSIKNIPSAGILKSLAYSYRKAQKTFAV*

SD17447.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:25:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16896-PA 337 GF16896-PA 1..337 1..342 1525 81.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:25:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16880-PA 342 GG16880-PA 1..342 1..342 1768 95.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:25:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18336-PA 338 GH18336-PA 1..337 1..341 1322 71.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:17:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG33331-PA 342 CG33331-PA 1..342 1..342 1780 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:25:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23316-PA 338 GI23316-PA 1..338 1..342 1305 70.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:25:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23851-PA 338 GL23851-PA 1..338 1..342 1383 78.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:25:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27077-PA 338 GA27077-PA 1..338 1..342 1386 78.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:25:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24189-PA 342 GM24189-PA 1..342 1..342 1800 98.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:25:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18981-PA 342 GD18981-PA 1..342 1..342 1793 98 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:25:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10320-PA 338 GJ10320-PA 1..338 1..342 1319 73.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:25:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18954-PA 346 GK18954-PA 1..345 1..341 1397 74.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:25:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24261-PA 342 GE24261-PA 1..342 1..342 1755 95.6 Plus

SD17447.hyp Sequence

Translation from 89 to 1117

> SD17447.hyp
MLDLYRRTVARFPLGSVSYMFAYGSGVKQQEGYGKVGNGNNLRPPPGTVV
DLVFCVRDARGFHAENLHRHPDHYSALRHLGPNFVAKYQERLGAGVYCNT
LVPLPDVGITIKYGVVSQEELLEDLLDWRHLYLAGRLHKPVTNLVNPSDN
PPLKAALERNLVSALQVALLLLPEKFTAYGLFHTIAGLSYKGDFRMIFGE
NKQKVHNIVSPQINDFFALYQPSLGQLSDYVAVNMKGQEPGSRKPAIIFE
QDKSSSATCQHLRQLPRELQKRLQRNAACRGDYTQVVNHLSMASQLPEVL
QASVNDIVWRSSVTQSIKNIPSAGILKSLAYSYRKAQKTFAV*

SD17447.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:40:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG33331-PA 342 CG33331-PA 1..342 1..342 1780 100 Plus