Clone SD18306 Report

Search the DGRC for SD18306

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:183
Well:6
Vector:pOT2
Associated Gene/TranscriptCG30010-RA
Protein status:SD18306.pep: gold
Sequenced Size:722

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1675 2002-01-01 Sim4 clustering to Release 2
CG30010 2002-05-18 Blastp of sequenced clone
CG30010 2003-01-01 Sim4 clustering to Release 3
CG30010 2008-04-29 Release 5.5 accounting
CG30010 2008-08-15 Release 5.9 accounting
CG30010 2008-12-18 5.12 accounting

Clone Sequence Records

SD18306.complete Sequence

722 bp (722 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119234

> SD18306.complete
TTATACTACGTTCTAGATCCCTTACAAACCTAAAATTCGTTAGATCTCCA
AGCATATCTTGCCGTTACGTACAATATAACCAAGGTCAATCTCCGGAGCC
AAAAATTCGCGAATACTTTTACTACATCGATCATGAGGGAATGCTCTTCC
TGGACGATGCAAAGATGAAAAACTTCACCAGCTGCTTTAAGGAGAAGGAT
TTCCTCAAGTTCTTTTTCAACCGACTGCGGCTAAACAAAACGAGCAGATA
TGAAAGCGAATTTCCATACATTTCCCTCTGTGGCCGCGAAAGGAATTTTA
TTAGGTGCGATGACACACCTGTTGTGTTTACTGAACAGCTGAGGAAGGAC
GATACGGAGGTGCTCAGCTATGCACACGCGGGACAGGTCCTTACCCTGCC
TTACGAACCCCACAAACTGTACATGGATCCGCGAAACGGAAGGGTCTATC
ATCCAGCTGCGCCACAGGTGGGCGGAATAGGCCTAGTCCGCTCCAAACTG
GCCATCGAGCTCAGCCAGCACTTTGAGTTTCTCGCTGGCGAGGCTTCCCC
CACACATTTCCAATGGAACGGAGAACGTTTAGAGTTGCAGAACGAGTGGG
TTAACAATACTCAGCGATTTCCCATGAACGAGGATTGTAAATAATTGAAT
AACTTTAATCGTTTTAAAATTGAGACAACGATAGAATATAACTTACAGAA
TATAAAAAAAAAAAAAAAAAAA

SD18306.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:19:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG30010-RA 899 CG30010-RA 171..874 1..704 3505 99.8 Plus
cbx-RB 969 cbx-RB 843..969 704..578 635 100 Minus
cbx-RA 1038 cbx-RA 969..1038 704..635 350 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:00:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5751494..5752054 143..703 2805 100 Plus
chr2R 21145070 chr2R 5751299..5751441 1..143 715 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:56:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:00:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9864016..9864577 143..704 2810 100 Plus
2R 25286936 2R 9863821..9863963 1..143 700 99.3 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:58:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 9865215..9865776 143..704 2810 100 Plus
2R 25260384 2R 9865020..9865162 1..143 700 99.3 Plus
Blast to na_te.dros performed 2019-03-15 20:00:54
Subject Length Description Subject Range Query Range Score Percent Strand
HMS-Beagle2 7220 HMS-Beagle2 Beagle2 7220bp 6260..6310 691..641 111 68.6 Minus
gypsy10 6006 gypsy10 GYPSY10 6006bp 5319..5364 129..173 110 73.9 Plus

SD18306.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:01:40 Download gff for SD18306.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5751299..5751441 1..143 100 -> Plus
chr2R 5751495..5752054 144..703 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:09:10 Download gff for SD18306.complete
Subject Subject Range Query Range Percent Splice Strand
CG30010-RA 1..504 141..644 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:49:07 Download gff for SD18306.complete
Subject Subject Range Query Range Percent Splice Strand
CG30010-RA 1..504 141..644 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:18:07 Download gff for SD18306.complete
Subject Subject Range Query Range Percent Splice Strand
CG30010-RA 1..504 141..644 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:40:29 Download gff for SD18306.complete
Subject Subject Range Query Range Percent Splice Strand
CG30010-RA 1..504 141..644 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:13:08 Download gff for SD18306.complete
Subject Subject Range Query Range Percent Splice Strand
CG30010-RA 1..504 141..644 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:01:42 Download gff for SD18306.complete
Subject Subject Range Query Range Percent Splice Strand
CG30010-RA 2..704 1..703 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:49:07 Download gff for SD18306.complete
Subject Subject Range Query Range Percent Splice Strand
CG30010-RA 2..704 1..703 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:18:07 Download gff for SD18306.complete
Subject Subject Range Query Range Percent Splice Strand
CG30010-RA 2..704 1..703 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:40:30 Download gff for SD18306.complete
Subject Subject Range Query Range Percent Splice Strand
CG30010-RA 2..704 1..703 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:13:08 Download gff for SD18306.complete
Subject Subject Range Query Range Percent Splice Strand
CG30010-RA 2..704 1..703 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:01:40 Download gff for SD18306.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9863821..9863963 1..143 99 -> Plus
2R 9864017..9864576 144..703 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:01:40 Download gff for SD18306.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9863821..9863963 1..143 99 -> Plus
2R 9864017..9864576 144..703 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:01:40 Download gff for SD18306.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9863821..9863963 1..143 99 -> Plus
2R 9864017..9864576 144..703 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:18:07 Download gff for SD18306.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5751326..5751468 1..143 99 -> Plus
arm_2R 5751522..5752081 144..703 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:10:54 Download gff for SD18306.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9865216..9865775 144..703 100   Plus
2R 9865020..9865162 1..143 99 -> Plus

SD18306.hyp Sequence

Translation from 2 to 643

> SD18306.hyp
ILRSRSLTNLKFVRSPSISCRYVQYNQGQSPEPKIREYFYYIDHEGMLFL
DDAKMKNFTSCFKEKDFLKFFFNRLRLNKTSRYESEFPYISLCGRERNFI
RCDDTPVVFTEQLRKDDTEVLSYAHAGQVLTLPYEPHKLYMDPRNGRVYH
PAAPQVGGIGLVRSKLAIELSQHFEFLAGEASPTHFQWNGERLELQNEWV
NNTQRFPMNEDCK*

SD18306.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:15:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG30010-PB 167 CG30010-PB 1..167 47..213 904 100 Plus
CG30010-PA 167 CG30010-PA 1..167 47..213 904 100 Plus

SD18306.pep Sequence

Translation from 140 to 643

> SD18306.pep
MLFLDDAKMKNFTSCFKEKDFLKFFFNRLRLNKTSRYESEFPYISLCGRE
RNFIRCDDTPVVFTEQLRKDDTEVLSYAHAGQVLTLPYEPHKLYMDPRNG
RVYHPAAPQVGGIGLVRSKLAIELSQHFEFLAGEASPTHFQWNGERLELQ
NEWVNNTQRFPMNEDCK*

SD18306.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 06:33:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11860-PA 215 GF11860-PA 49..214 1..166 780 84.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:33:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24112-PA 159 GG24112-PA 1..159 9..167 819 94.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 06:33:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21678-PA 166 GH21678-PA 1..164 1..163 580 65.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:43:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG30010-PB 167 CG30010-PB 1..167 1..167 904 100 Plus
CG30010-PA 167 CG30010-PA 1..167 1..167 904 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 06:33:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18833-PA 199 GI18833-PA 31..193 1..160 542 67.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 06:33:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10098-PA 161 GL10098-PA 1..161 9..167 743 84.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 06:33:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25076-PA 169 GA25076-PA 1..169 1..167 787 85.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 06:33:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21159-PA 215 GM21159-PA 49..215 1..167 852 92.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 06:33:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10691-PA 167 GD10691-PA 1..167 1..167 856 93.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 06:33:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21860-PA 170 GJ21860-PA 1..168 2..167 652 70.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 06:33:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19411-PA 173 GK19411-PA 1..167 2..165 693 74.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:33:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19309-PA 215 GE19309-PA 49..215 1..167 857 94.6 Plus