Clone SD18370 Report

Search the DGRC for SD18370

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:183
Well:70
Vector:pOT2
Associated Gene/TranscriptPHGPx-RC
Protein status:SD18370.pep: gold
Preliminary Size:2269
Sequenced Size:906

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12013 2004-01-13 Blastp of sequenced clone
PHGPx 2008-04-29 Release 5.5 accounting
PHGPx 2008-08-15 Release 5.9 accounting
PHGPx 2008-12-18 5.12 accounting

Clone Sequence Records

SD18370.complete Sequence

906 bp (906 high quality bases) assembled on 2004-01-13

GenBank Submission: BT011331

> SD18370.complete
CAGAATCTCGGCATTCGCATTCTATATTTGTATCCCTGCATCCGAAACTC
GCAGCAGATCGTTGTGAAATCGTACACATAGTCGATATATAGCGCAGTAA
TGGCTGGCCGCTCCATCGTCCACTTTTTTCTGGGGTCCGTGGCAATCGCC
CTGGGATCGTACATCTACTTCACCATGCAAATCGACATGTCTGCTAACGG
AGATTACAAGAACGCCGCCTCGATCTACGAGTTCACCGTGAAGGATACCC
ATGGCAACGATGTTTCCCTGGAAAAGTACAAGGGCAAGGTGGTCCTGGTG
GTGAACATCGCCTCCAAGTGCGGCCTGACCAAGAACAACTACGAGAAGCT
GACGGATCTAAAGGAGAAGTACGGCGAGCGCGGCCTGGTGATCCTCAACT
TCCCGTGCAATCAGTTTGGGTCCCAGATGCCGGAGGCCGATGGAGAGGCC
ATGGTGTGCCACCTGCGCGACTCCAAGGCTGACATCGGCGAGGTGTTCGC
CAAGGTCGATGTGAATGGAGACAATGCGGCGCCGCTGTACAAATACCTAA
AGGCCAAGCAGACCGGCACCCTGGGCAGCGGAATCAAGTGGAACTTCACC
AAGTTTCTGGTGAACAAGGAGGGCGTGCCCATCAACCGATATGCCCCGAC
CACCGATCCCATGGACATCGCCAAGGACATTGAAAAGCTGCTGTAGATGT
GCCCTAGACGTTAGCTGCTCTTTTGGACTGTGTTTTCGCGTAGCTTTAGC
TTGTAACCGTCTGGCCACAGATAGTCTTGTGGCCGGCCACATGCACCGCA
TGGTATATATATTGTCTACTCCTTACTGGTTTTGATTCCCACCCGCAAAC
ATAATAAACGCCATTCGTGGTTACCACACTAAAAAAAAAAAAAAAAAAAA
AAAAAA

SD18370.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:09:40
Subject Length Description Subject Range Query Range Score Percent Strand
PHGPx-RC 1212 PHGPx-RC 284..1164 1..881 4390 99.8 Plus
PHGPx-RA 867 PHGPx-RA 117..819 179..881 3515 100 Plus
PHGPx-RD 1078 PHGPx-RD 330..1030 181..881 3505 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:01:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 3327656..3328033 503..880 1875 99.7 Plus
chr3L 24539361 chr3L 3327267..3327592 181..506 1585 99.1 Plus
chr3L 24539361 chr3L 3325943..3326122 1..180 900 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:56:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:01:53
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3328249..3328627 503..881 1895 100 Plus
3L 28110227 3L 3327860..3328185 181..506 1630 100 Plus
3L 28110227 3L 3326533..3326712 1..180 885 99.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:53:51
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 3328249..3328627 503..881 1895 100 Plus
3L 28103327 3L 3327860..3328185 181..506 1630 100 Plus
3L 28103327 3L 3326533..3326712 1..180 885 99.4 Plus
Blast to na_te.dros performed on 2019-03-16 10:01:53 has no hits.

SD18370.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:03:03 Download gff for SD18370.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 3325943..3326122 1..180 100 -> Plus
chr3L 3327267..3327590 181..504 99 -> Plus
chr3L 3327658..3328033 505..880 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:09:11 Download gff for SD18370.complete
Subject Subject Range Query Range Percent Splice Strand
PHGPx-RC 1..597 100..696 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:42:32 Download gff for SD18370.complete
Subject Subject Range Query Range Percent Splice Strand
PHGPx-RC 1..597 100..696 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:08:41 Download gff for SD18370.complete
Subject Subject Range Query Range Percent Splice Strand
PHGPx-RC 1..597 100..696 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:31:22 Download gff for SD18370.complete
Subject Subject Range Query Range Percent Splice Strand
PHGPx-RC 1..597 100..696 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:52:22 Download gff for SD18370.complete
Subject Subject Range Query Range Percent Splice Strand
PHGPx-RC 1..597 100..696 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:52:18 Download gff for SD18370.complete
Subject Subject Range Query Range Percent Splice Strand
PHGPx-RC 243..1122 1..880 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:42:32 Download gff for SD18370.complete
Subject Subject Range Query Range Percent Splice Strand
PHGPx-RC 243..1122 1..880 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:08:41 Download gff for SD18370.complete
Subject Subject Range Query Range Percent Splice Strand
PHGPx-RC 269..1148 1..880 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:31:22 Download gff for SD18370.complete
Subject Subject Range Query Range Percent Splice Strand
PHGPx-RC 243..1122 1..880 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:52:22 Download gff for SD18370.complete
Subject Subject Range Query Range Percent Splice Strand
PHGPx-RC 269..1148 1..880 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:03:03 Download gff for SD18370.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3326533..3326712 1..180 99 -> Plus
3L 3327860..3328183 181..504 100 -> Plus
3L 3328251..3328626 505..880 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:03:03 Download gff for SD18370.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3326533..3326712 1..180 99 -> Plus
3L 3327860..3328183 181..504 100 -> Plus
3L 3328251..3328626 505..880 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:03:03 Download gff for SD18370.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3326533..3326712 1..180 99 -> Plus
3L 3327860..3328183 181..504 100 -> Plus
3L 3328251..3328626 505..880 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:08:41 Download gff for SD18370.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3326533..3326712 1..180 99 -> Plus
arm_3L 3327860..3328183 181..504 100 -> Plus
arm_3L 3328251..3328626 505..880 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:03:55 Download gff for SD18370.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3327860..3328183 181..504 100 -> Plus
3L 3328251..3328626 505..880 100   Plus
3L 3326533..3326712 1..180 99 -> Plus

SD18370.pep Sequence

Translation from 99 to 695

> SD18370.pep
MAGRSIVHFFLGSVAIALGSYIYFTMQIDMSANGDYKNAASIYEFTVKDT
HGNDVSLEKYKGKVVLVVNIASKCGLTKNNYEKLTDLKEKYGERGLVILN
FPCNQFGSQMPEADGEAMVCHLRDSKADIGEVFAKVDVNGDNAAPLYKYL
KAKQTGTLGSGIKWNFTKFLVNKEGVPINRYAPTTDPMDIAKDIEKLL*

SD18370.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:25:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10532-PA 240 GF10532-PA 71..240 28..198 883 95.3 Plus
Dana\GF13732-PA 195 GF13732-PA 40..191 42..198 452 53.5 Plus
Dana\GF20161-PA 187 GF20161-PA 5..103 61..198 367 58 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:25:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15132-PA 265 GG15132-PA 95..265 28..198 915 98.2 Plus
Dere\GG20925-PA 193 GG20925-PA 6..191 5..198 434 46.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:25:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15953-PA 245 GH15953-PA 76..245 28..198 881 95.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:07:46
Subject Length Description Subject Range Query Range Score Percent Strand
PHGPx-PC 198 CG12013-PC 1..198 1..198 1032 100 Plus
PHGPx-PD 238 CG12013-PD 68..238 28..198 897 100 Plus
PHGPx-PA 169 CG12013-PA 1..169 30..198 887 100 Plus
CG15116-PA 193 CG15116-PA 33..191 35..198 403 50.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:25:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16605-PA 213 GI16605-PA 1..213 1..198 928 81.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:25:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16141-PA 238 GL16141-PA 52..238 13..198 870 85 Plus
Dper\GL10571-PA 201 GL10571-PA 37..196 39..198 460 53.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:25:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11336-PA 238 GA11336-PA 52..238 13..198 870 85 Plus
Dpse\GA13504-PA 201 GA13504-PA 37..196 39..198 462 53.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:25:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14565-PA 253 GM14565-PA 1..253 1..198 925 73.1 Plus
Dsec\GM19853-PA 193 GM19853-PA 33..191 35..198 422 50 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:25:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13757-PA 196 GD13757-PA 1..190 1..135 588 64.2 Plus
Dsim\GD25340-PA 193 GD25340-PA 33..191 35..198 424 50.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:25:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12858-PA 244 GJ12858-PA 60..244 13..198 872 88.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:26:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20508-PA 254 GK20508-PA 73..254 17..198 861 86.3 Plus
Dwil\GK19311-PA 194 GK19311-PA 39..190 41..198 430 51.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:26:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21358-PA 265 GE21358-PA 95..265 28..198 912 97.7 Plus
Dyak\GE13862-PA 193 GE13862-PA 39..191 41..198 435 52.5 Plus

SD18370.hyp Sequence

Translation from 99 to 695

> SD18370.hyp
MAGRSIVHFFLGSVAIALGSYIYFTMQIDMSANGDYKNAASIYEFTVKDT
HGNDVSLEKYKGKVVLVVNIASKCGLTKNNYEKLTDLKEKYGERGLVILN
FPCNQFGSQMPEADGEAMVCHLRDSKADIGEVFAKVDVNGDNAAPLYKYL
KAKQTGTLGSGIKWNFTKFLVNKEGVPINRYAPTTDPMDIAKDIEKLL*

SD18370.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:14:50
Subject Length Description Subject Range Query Range Score Percent Strand
PHGPx-PC 198 CG12013-PC 1..198 1..198 1032 100 Plus
PHGPx-PD 238 CG12013-PD 68..238 28..198 897 100 Plus
PHGPx-PA 169 CG12013-PA 1..169 30..198 887 100 Plus
CG15116-PA 193 CG15116-PA 33..191 35..198 403 50.6 Plus