BDGP Sequence Production Resources |
Search the DGRC for SD18780
Library: | SD |
Tissue Source: | Drosophila melanogaster Schneider L2 cell culture |
Created by: | Ling Hong |
Date Registered: | 1999-02-25 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 187 |
Well: | 80 |
Vector: | pOT2 |
Associated Gene/Transcript | CG5569-RA |
Protein status: | SD18780.pep: gold |
Preliminary Size: | 660 |
Sequenced Size: | 727 |
Gene | Date | Evidence |
---|---|---|
CG5569 | 2002-01-01 | Sim4 clustering to Release 2 |
CG5569 | 2002-05-18 | Blastp of sequenced clone |
CG5569 | 2003-01-01 | Sim4 clustering to Release 3 |
CG5569 | 2008-04-29 | Release 5.5 accounting |
CG5569 | 2008-08-15 | Release 5.9 accounting |
CG5569 | 2008-12-18 | 5.12 accounting |
727 bp (727 high quality bases) assembled on 2002-05-18
GenBank Submission: AY119235
> SD18780.complete AAATTGTTGTAATAGCCATTAATTACTTTTCTAACACAAGACCATGATTG CGCGCACCCTGCGAACGGTGGGCCGGCAAGGTCGCAACCTTCTGCTACCG CGCATCACCGCCTGTCGCCCACTTCACGCTATTCCGGCCAACTTCAGCAA GGCCTACGACCACGACGGGAAGACCAAAGTCACCATCTTCAACACCGAAA CGGATCTGGGCCTTATGGTCACCGGCTACAGCCAGTACGGCTTCCGGCTC AACAACGACATGGTCCTCATTGGCCCCATCTCCGTGTTTCCCAGATCGGT TCTGTCCTGGAACGTCAACAGCTTTGAGGACATCAACGAGGACAGCCTCA GTCTCTTCCCCACCCTGGAGCCAAAGATCGACGTGCTTATCATTGGCATT GGCGACCAAGCACCGCCCCCAGCTCTTTCCAAGAGGATCATCGAGTTCAT GAAGAAGTACAAGATAAACGTAGAGATCCTGCGCACGGAGCAGGCATGTG CCACCTTCAACTTCCTGAATGCCGAGAACCGAATGGTGGCCTGCGCCCTG ATACCCCCGCTGCACCTGTCCTACAACGAGAACGACATTCTGCAAGCGAA GCTGCGGAAGAAGGAGCTCTACGAGACCGAATAGGATTAGTTAGACACAT CTAATGATTGTTTGAAAGGCTGGTGCTCTGTTAGAAATTAAACTGTTTTG TAAAATTCAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 19751557..19751850 | 1..294 | 1470 | 100 | Plus |
chr2R | 21145070 | chr2R | 19752479..19752697 | 490..708 | 1095 | 100 | Plus |
chr2R | 21145070 | chr2R | 19752227..19752429 | 292..494 | 1000 | 99.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 23865480..23865773 | 1..294 | 1470 | 100 | Plus |
2R | 25286936 | 2R | 23866436..23866655 | 490..709 | 1100 | 100 | Plus |
2R | 25286936 | 2R | 23866184..23866386 | 292..494 | 1015 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 23866679..23866972 | 1..294 | 1470 | 100 | Plus |
2R | 25260384 | 2R | 23867635..23867854 | 490..709 | 1100 | 100 | Plus |
2R | 25260384 | 2R | 23867383..23867585 | 292..494 | 1015 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 19751557..19751850 | 1..294 | 100 | -> | Plus |
chr2R | 19752230..19752428 | 295..493 | 99 | -> | Plus |
chr2R | 19752483..19752697 | 494..708 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5569-RA | 1..591 | 44..634 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5569-RA | 1..591 | 44..634 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5569-RA | 1..591 | 44..634 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5569-RA | 1..591 | 44..634 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5569-RA | 1..591 | 44..634 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5569-RA | 60..767 | 1..708 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5569-RA | 60..767 | 1..708 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5569-RA | 67..774 | 1..708 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5569-RA | 60..767 | 1..708 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5569-RA | 67..774 | 1..708 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 23865480..23865773 | 1..294 | 100 | -> | Plus |
2R | 23866187..23866385 | 295..493 | 100 | -> | Plus |
2R | 23866440..23866654 | 494..708 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 23865480..23865773 | 1..294 | 100 | -> | Plus |
2R | 23866187..23866385 | 295..493 | 100 | -> | Plus |
2R | 23866440..23866654 | 494..708 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 23865480..23865773 | 1..294 | 100 | -> | Plus |
2R | 23866187..23866385 | 295..493 | 100 | -> | Plus |
2R | 23866440..23866654 | 494..708 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 19753003..19753296 | 1..294 | 100 | -> | Plus |
arm_2R | 19753710..19753908 | 295..493 | 100 | -> | Plus |
arm_2R | 19753963..19754177 | 494..708 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 23866697..23866990 | 1..294 | 100 | -> | Plus |
2R | 23867404..23867602 | 295..493 | 100 | -> | Plus |
2R | 23867657..23867871 | 494..708 | 100 | Plus |
Translation from 43 to 633
> SD18780.pep MIARTLRTVGRQGRNLLLPRITACRPLHAIPANFSKAYDHDGKTKVTIFN TETDLGLMVTGYSQYGFRLNNDMVLIGPISVFPRSVLSWNVNSFEDINED SLSLFPTLEPKIDVLIIGIGDQAPPPALSKRIIEFMKKYKINVEILRTEQ ACATFNFLNAENRMVACALIPPLHLSYNENDILQAKLRKKELYETE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12867-PA | 196 | GF12867-PA | 1..196 | 1..196 | 933 | 86.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22894-PA | 196 | GG22894-PA | 1..196 | 1..196 | 1012 | 96.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21686-PA | 198 | GH21686-PA | 1..198 | 1..196 | 795 | 75.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG5569-PA | 196 | CG5569-PA | 1..196 | 1..196 | 1011 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI18840-PA | 198 | GI18840-PA | 17..198 | 14..196 | 789 | 78.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11170-PA | 196 | GL11170-PA | 1..196 | 1..196 | 872 | 82.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA18977-PA | 196 | GA18977-PA | 1..196 | 1..196 | 872 | 82.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM16053-PA | 196 | GM16053-PA | 1..196 | 1..196 | 1041 | 99 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11803-PA | 196 | GD11803-PA | 1..196 | 1..196 | 1035 | 99 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ21869-PA | 197 | GJ21869-PA | 1..197 | 1..196 | 784 | 73.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK15710-PA | 204 | GK15710-PA | 1..204 | 1..196 | 809 | 75.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE14332-PA | 196 | GE14332-PA | 1..196 | 1..196 | 1008 | 96.4 | Plus |
Translation from 43 to 633
> SD18780.hyp MIARTLRTVGRQGRNLLLPRITACRPLHAIPANFSKAYDHDGKTKVTIFN TETDLGLMVTGYSQYGFRLNNDMVLIGPISVFPRSVLSWNVNSFEDINED SLSLFPTLEPKIDVLIIGIGDQAPPPALSKRIIEFMKKYKINVEILRTEQ ACATFNFLNAENRMVACALIPPLHLSYNENDILQAKLRKKELYETE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG5569-PA | 196 | CG5569-PA | 1..196 | 1..196 | 1011 | 100 | Plus |