Clone SD18780 Report

Search the DGRC for SD18780

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:187
Well:80
Vector:pOT2
Associated Gene/TranscriptCG5569-RA
Protein status:SD18780.pep: gold
Preliminary Size:660
Sequenced Size:727

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5569 2002-01-01 Sim4 clustering to Release 2
CG5569 2002-05-18 Blastp of sequenced clone
CG5569 2003-01-01 Sim4 clustering to Release 3
CG5569 2008-04-29 Release 5.5 accounting
CG5569 2008-08-15 Release 5.9 accounting
CG5569 2008-12-18 5.12 accounting

Clone Sequence Records

SD18780.complete Sequence

727 bp (727 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119235

> SD18780.complete
AAATTGTTGTAATAGCCATTAATTACTTTTCTAACACAAGACCATGATTG
CGCGCACCCTGCGAACGGTGGGCCGGCAAGGTCGCAACCTTCTGCTACCG
CGCATCACCGCCTGTCGCCCACTTCACGCTATTCCGGCCAACTTCAGCAA
GGCCTACGACCACGACGGGAAGACCAAAGTCACCATCTTCAACACCGAAA
CGGATCTGGGCCTTATGGTCACCGGCTACAGCCAGTACGGCTTCCGGCTC
AACAACGACATGGTCCTCATTGGCCCCATCTCCGTGTTTCCCAGATCGGT
TCTGTCCTGGAACGTCAACAGCTTTGAGGACATCAACGAGGACAGCCTCA
GTCTCTTCCCCACCCTGGAGCCAAAGATCGACGTGCTTATCATTGGCATT
GGCGACCAAGCACCGCCCCCAGCTCTTTCCAAGAGGATCATCGAGTTCAT
GAAGAAGTACAAGATAAACGTAGAGATCCTGCGCACGGAGCAGGCATGTG
CCACCTTCAACTTCCTGAATGCCGAGAACCGAATGGTGGCCTGCGCCCTG
ATACCCCCGCTGCACCTGTCCTACAACGAGAACGACATTCTGCAAGCGAA
GCTGCGGAAGAAGGAGCTCTACGAGACCGAATAGGATTAGTTAGACACAT
CTAATGATTGTTTGAAAGGCTGGTGCTCTGTTAGAAATTAAACTGTTTTG
TAAAATTCAAAAAAAAAAAAAAAAAAA

SD18780.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:27:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG5569-RA 777 CG5569-RA 67..775 1..709 3545 100 Plus
Thiolase-RA 1654 Thiolase-RA 1600..1654 709..655 275 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:45:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19751557..19751850 1..294 1470 100 Plus
chr2R 21145070 chr2R 19752479..19752697 490..708 1095 100 Plus
chr2R 21145070 chr2R 19752227..19752429 292..494 1000 99.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:56:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:45:44
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23865480..23865773 1..294 1470 100 Plus
2R 25286936 2R 23866436..23866655 490..709 1100 100 Plus
2R 25286936 2R 23866184..23866386 292..494 1015 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:04:07
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23866679..23866972 1..294 1470 100 Plus
2R 25260384 2R 23867635..23867854 490..709 1100 100 Plus
2R 25260384 2R 23867383..23867585 292..494 1015 100 Plus
Blast to na_te.dros performed on 2019-03-15 20:45:45 has no hits.

SD18780.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:46:51 Download gff for SD18780.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19751557..19751850 1..294 100 -> Plus
chr2R 19752230..19752428 295..493 99 -> Plus
chr2R 19752483..19752697 494..708 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:09:17 Download gff for SD18780.complete
Subject Subject Range Query Range Percent Splice Strand
CG5569-RA 1..591 44..634 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:57:51 Download gff for SD18780.complete
Subject Subject Range Query Range Percent Splice Strand
CG5569-RA 1..591 44..634 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:19:49 Download gff for SD18780.complete
Subject Subject Range Query Range Percent Splice Strand
CG5569-RA 1..591 44..634 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:48:41 Download gff for SD18780.complete
Subject Subject Range Query Range Percent Splice Strand
CG5569-RA 1..591 44..634 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:27:35 Download gff for SD18780.complete
Subject Subject Range Query Range Percent Splice Strand
CG5569-RA 1..591 44..634 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:14:13 Download gff for SD18780.complete
Subject Subject Range Query Range Percent Splice Strand
CG5569-RA 60..767 1..708 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:57:51 Download gff for SD18780.complete
Subject Subject Range Query Range Percent Splice Strand
CG5569-RA 60..767 1..708 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:19:49 Download gff for SD18780.complete
Subject Subject Range Query Range Percent Splice Strand
CG5569-RA 67..774 1..708 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:48:41 Download gff for SD18780.complete
Subject Subject Range Query Range Percent Splice Strand
CG5569-RA 60..767 1..708 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:27:35 Download gff for SD18780.complete
Subject Subject Range Query Range Percent Splice Strand
CG5569-RA 67..774 1..708 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:46:51 Download gff for SD18780.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23865480..23865773 1..294 100 -> Plus
2R 23866187..23866385 295..493 100 -> Plus
2R 23866440..23866654 494..708 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:46:51 Download gff for SD18780.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23865480..23865773 1..294 100 -> Plus
2R 23866187..23866385 295..493 100 -> Plus
2R 23866440..23866654 494..708 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:46:51 Download gff for SD18780.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23865480..23865773 1..294 100 -> Plus
2R 23866187..23866385 295..493 100 -> Plus
2R 23866440..23866654 494..708 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:19:49 Download gff for SD18780.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19753003..19753296 1..294 100 -> Plus
arm_2R 19753710..19753908 295..493 100 -> Plus
arm_2R 19753963..19754177 494..708 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:20:04 Download gff for SD18780.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23866697..23866990 1..294 100 -> Plus
2R 23867404..23867602 295..493 100 -> Plus
2R 23867657..23867871 494..708 100   Plus

SD18780.pep Sequence

Translation from 43 to 633

> SD18780.pep
MIARTLRTVGRQGRNLLLPRITACRPLHAIPANFSKAYDHDGKTKVTIFN
TETDLGLMVTGYSQYGFRLNNDMVLIGPISVFPRSVLSWNVNSFEDINED
SLSLFPTLEPKIDVLIIGIGDQAPPPALSKRIIEFMKKYKINVEILRTEQ
ACATFNFLNAENRMVACALIPPLHLSYNENDILQAKLRKKELYETE*

SD18780.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:53:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12867-PA 196 GF12867-PA 1..196 1..196 933 86.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:53:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22894-PA 196 GG22894-PA 1..196 1..196 1012 96.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:53:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21686-PA 198 GH21686-PA 1..198 1..196 795 75.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:24:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG5569-PA 196 CG5569-PA 1..196 1..196 1011 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:53:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18840-PA 198 GI18840-PA 17..198 14..196 789 78.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:53:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11170-PA 196 GL11170-PA 1..196 1..196 872 82.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:53:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18977-PA 196 GA18977-PA 1..196 1..196 872 82.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:53:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16053-PA 196 GM16053-PA 1..196 1..196 1041 99 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:53:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11803-PA 196 GD11803-PA 1..196 1..196 1035 99 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:53:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21869-PA 197 GJ21869-PA 1..197 1..196 784 73.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:53:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15710-PA 204 GK15710-PA 1..204 1..196 809 75.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:53:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14332-PA 196 GE14332-PA 1..196 1..196 1008 96.4 Plus

SD18780.hyp Sequence

Translation from 43 to 633

> SD18780.hyp
MIARTLRTVGRQGRNLLLPRITACRPLHAIPANFSKAYDHDGKTKVTIFN
TETDLGLMVTGYSQYGFRLNNDMVLIGPISVFPRSVLSWNVNSFEDINED
SLSLFPTLEPKIDVLIIGIGDQAPPPALSKRIIEFMKKYKINVEILRTEQ
ACATFNFLNAENRMVACALIPPLHLSYNENDILQAKLRKKELYETE*

SD18780.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:10:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG5569-PA 196 CG5569-PA 1..196 1..196 1011 100 Plus