Clone SD19268 Report

Search the DGRC for SD19268

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:192
Well:68
Vector:pOT2
Associated Gene/TranscriptCG8778-RA
Protein status:SD19268.pep: gold
Sequenced Size:1110

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8778 2008-04-29 Release 5.5 accounting
CG8778 2008-04-29 Picked prior to 5.5
CG8778 2008-08-15 Release 5.9 accounting
CG8778 2008-12-18 5.12 accounting

Clone Sequence Records

SD19268.complete Sequence

1110 bp assembled on 2007-09-24

GenBank Submission: BT031029

> SD19268.complete
CAGCTTATTGCCTTTTCTTGCTTTCTTTTTATCTGTTTTCAACGTTAAAA
TGTCAATGTTAATAAAAAGAGCGTCTGGTTTAGCTCGACAGTTAGCCCGG
CCACTTGTTGCATCACGTAATTTGGCGTCGGCAGCGCCCTATGGCGATGG
AACTGAAGTTCTCGTGGAGCGTTTGGATGGAGCTCGGCAGGGTATCTCAG
TTATTGGCCTAAACCGACCAGCAGCAAAGAATTCCTTTAGCCGGGGAATG
GTGGAGACCTTCAACGATGTCCTGGAAGATATAAAGAAGGATAATGGATC
GAGGGTGGTTGTATTGAGGAGTCTGAGCCCTGGAATCTTCTGTGCCGGAG
CGGATTTGAAAGAGCGAAAAGGCATGACTCCCGAGGAAGCCACCGAATTT
GTAAAAGAGCTCAGGGGACTGCTTATTGCCATTGAGCAGCTGCCCATGCC
GGTAATCGCCGCTGTGGATGGAGCTGCTCTCGGCGGAGGTCTGGAAATGG
CTCTGGCCTGTGACATCCGGACTGCTGCTAGCGACACGAAGATGGGTCTG
GTGGAGACAAGGTTAGCCATCATACCAGGAGCTGGTGGCACCCAAAGACT
GCCCCGCATTCTGTCCCCTGCTCTGGCCAAAGAACTCATTTTCACGGCAC
GAGTGTTTAACGGAGCAGAGGCGAAAGATCTGGGTCTGGTTAACCATGTA
GTGAAACAGAACGAAACCCAGGATGCCGCCTATCAGCAGGCACTTAAATT
GGCAGAGGAAATTCTCCCGAATGGGCCAGTGGGCGTGCGAATGGCCAAAC
TGGCCATTGACAAGGGCATGCAGGTGGACCTGGCCACCGGCTACTCCATC
GAAGAGATCTGCTACTCGCAGGTGATACCCACTAAGGATCGTTTGGAGGG
ACTCGCTGCCTTTGCCGAGAAGCGGAAGCCCGTCTACAAGGGGGAGTAAA
TAGATATCGTGCCACTCCCCTAACGTTAAGCTGAAAATTGCATTTATTAT
TTAACCTGTTACTGTTGTAGAAACACTTAAGCGGCAAAGTCCAGTTCAAT
TGTTTTTATTAAAAGCATTCGATCCTATCGAGCTGCCAAATAAAAAAAAA
AAAAAAAAAA

SD19268.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:36:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG8778-RA 1270 CG8778-RA 52..1144 1..1093 5465 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:57:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8538552..8539273 1091..370 3505 99 Minus
chr2R 21145070 chr2R 8539337..8539708 372..1 1860 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:56:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:57:23
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12651299..12652022 1093..370 3620 100 Minus
2R 25286936 2R 12652083..12652454 372..1 1860 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:33:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12652498..12653221 1093..370 3620 100 Minus
2R 25260384 2R 12653282..12653653 372..1 1860 100 Minus
Blast to na_te.dros performed on 2019-03-15 18:57:24 has no hits.

SD19268.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:58:24 Download gff for SD19268.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8539338..8539708 1..371 100   Minus
chr2R 8538552..8539271 372..1091 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:09:19 Download gff for SD19268.complete
Subject Subject Range Query Range Percent Splice Strand
CG8778-RA 1..900 50..949 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:07:21 Download gff for SD19268.complete
Subject Subject Range Query Range Percent Splice Strand
CG8778-RA 1..900 50..949 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:37:35 Download gff for SD19268.complete
Subject Subject Range Query Range Percent Splice Strand
CG8778-RA 1..900 50..949 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:53:31 Download gff for SD19268.complete
Subject Subject Range Query Range Percent Splice Strand
CG8778-RA 1..900 50..949 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:06:09 Download gff for SD19268.complete
Subject Subject Range Query Range Percent Splice Strand
CG8778-RA 1..900 50..949 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:04:05 Download gff for SD19268.complete
Subject Subject Range Query Range Percent Splice Strand
CG8778-RA 29..1115 1..1087 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:07:21 Download gff for SD19268.complete
Subject Subject Range Query Range Percent Splice Strand
CG8778-RA 29..1119 1..1091 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:37:35 Download gff for SD19268.complete
Subject Subject Range Query Range Percent Splice Strand
CG8778-RA 34..1124 1..1091 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:53:31 Download gff for SD19268.complete
Subject Subject Range Query Range Percent Splice Strand
CG8778-RA 29..1115 1..1087 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:06:09 Download gff for SD19268.complete
Subject Subject Range Query Range Percent Splice Strand
CG8778-RA 34..1124 1..1091 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:58:24 Download gff for SD19268.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12651301..12652020 372..1091 100 <- Minus
2R 12652084..12652454 1..371 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:58:24 Download gff for SD19268.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12651301..12652020 372..1091 100 <- Minus
2R 12652084..12652454 1..371 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:58:24 Download gff for SD19268.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12651301..12652020 372..1091 100 <- Minus
2R 12652084..12652454 1..371 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:37:35 Download gff for SD19268.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8538806..8539525 372..1091 100 <- Minus
arm_2R 8539589..8539959 1..371 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:59:35 Download gff for SD19268.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12652500..12653219 372..1091 100 <- Minus
2R 12653283..12653653 1..371 100   Minus

SD19268.hyp Sequence

Translation from 0 to 948

> SD19268.hyp
SLLPFLAFFLSVFNVKMSMLIKRASGLARQLARPLVASRNLASAAPYGDG
TEVLVERLDGARQGISVIGLNRPAAKNSFSRGMVETFNDVLEDIKKDNGS
RVVVLRSLSPGIFCAGADLKERKGMTPEEATEFVKELRGLLIAIEQLPMP
VIAAVDGAALGGGLEMALACDIRTAASDTKMGLVETRLAIIPGAGGTQRL
PRILSPALAKELIFTARVFNGAEAKDLGLVNHVVKQNETQDAAYQQALKL
AEEILPNGPVGVRMAKLAIDKGMQVDLATGYSIEEICYSQVIPTKDRLEG
LAAFAEKRKPVYKGE*

SD19268.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:00:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG8778-PA 299 CG8778-PA 1..299 17..315 1479 100 Plus
CG6543-PA 295 CG6543-PA 11..295 23..315 376 34.5 Plus
CG6543-PB 295 CG6543-PB 11..295 23..315 376 34.5 Plus
Mtpalpha-PA 783 CG4389-PA 6..233 8..234 279 33.3 Plus
Mtpalpha-PB 744 CG4389-PB 20..194 64..234 271 38.3 Plus

SD19268.pep Sequence

Translation from 49 to 948

> SD19268.pep
MSMLIKRASGLARQLARPLVASRNLASAAPYGDGTEVLVERLDGARQGIS
VIGLNRPAAKNSFSRGMVETFNDVLEDIKKDNGSRVVVLRSLSPGIFCAG
ADLKERKGMTPEEATEFVKELRGLLIAIEQLPMPVIAAVDGAALGGGLEM
ALACDIRTAASDTKMGLVETRLAIIPGAGGTQRLPRILSPALAKELIFTA
RVFNGAEAKDLGLVNHVVKQNETQDAAYQQALKLAEEILPNGPVGVRMAK
LAIDKGMQVDLATGYSIEEICYSQVIPTKDRLEGLAAFAEKRKPVYKGE*

SD19268.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:54:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11465-PA 299 GF11465-PA 1..299 1..299 1380 88 Plus
Dana\GF11161-PA 293 GF11161-PA 22..293 17..299 373 33.8 Plus
Dana\GF17958-PA 375 GF17958-PA 49..227 37..218 221 31 Plus
Dana\GF20237-PA 318 GF20237-PA 30..315 23..296 220 26.8 Plus
Dana\GF21951-PA 1092 GF21951-PA 371..546 47..218 216 38.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:54:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22562-PA 299 GG22562-PA 1..299 1..299 1476 95.7 Plus
Dere\GG22466-PA 294 GG22466-PA 7..294 3..299 389 34.3 Plus
Dere\GG12104-PA 329 GG12104-PA 12..259 5..266 236 29.9 Plus
Dere\GG24022-PA 783 GG24022-PA 33..234 19..219 234 37.1 Plus
Dere\GG18938-PA 378 GG18938-PA 41..227 26..218 216 31.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:54:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22640-PA 298 GH22640-PA 1..298 1..299 1249 80.3 Plus
Dgri\GH20865-PA 293 GH20865-PA 11..293 7..299 388 34.2 Plus
Dgri\GH12615-PA 294 GH12615-PA 37..291 52..296 227 30.2 Plus
Dgri\GH21207-PA 382 GH21207-PA 1..229 3..218 215 28.6 Plus
Dgri\GH11058-PA 785 GH11058-PA 25..254 7..236 211 34.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:44:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG8778-PA 299 CG8778-PA 1..299 1..299 1479 100 Plus
Echs1-PA 295 CG6543-PA 11..295 7..299 376 34.5 Plus
Echs1-PB 295 CG6543-PB 11..295 7..299 376 34.5 Plus
Mtpalpha-PB 744 CG4389-PB 20..194 48..218 271 38.3 Plus
Mtpalpha-PA 783 CG4389-PA 59..233 48..218 271 38.3 Plus
CG5611-PC 326 CG5611-PC 24..259 19..266 237 31.2 Plus
CG5611-PA 326 CG5611-PA 24..259 19..266 237 31.2 Plus
CG9577-PA 312 CG9577-PA 1..262 3..250 222 28.3 Plus
CG5844-PA 378 CG5844-PA 41..245 26..236 220 30.5 Plus
CG6984-PA 285 CG6984-PA 29..283 32..297 185 26.3 Plus
CG4594-PB 280 CG4594-PB 33..207 46..222 181 27.7 Plus
CG4594-PA 280 CG4594-PA 33..207 46..222 181 27.7 Plus
CG5044-PA 385 CG5044-PA 56..228 51..225 174 28.4 Plus
CG5044-PB 386 CG5044-PB 57..229 51..225 174 28.4 Plus
CG4598-PB 281 CG4598-PB 33..207 46..222 171 26 Plus
CG4598-PA 281 CG4598-PA 33..207 46..222 171 26 Plus
Dci-PA 262 CG13890-PA 8..219 36..250 168 25.7 Plus
CG4592-PB 287 CG4592-PB 1..216 3..222 163 24.3 Plus
CG4592-PA 287 CG4592-PA 1..216 3..222 163 24.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:54:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21154-PA 301 GI21154-PA 1..301 1..299 1284 82.7 Plus
Dmoj\GI20973-PA 293 GI20973-PA 7..293 3..299 398 34.4 Plus
Dmoj\GI11030-PA 310 GI11030-PA 53..307 52..296 248 30.5 Plus
Dmoj\GI17575-PA 791 GI17575-PA 66..270 47..238 214 35.4 Plus
Dmoj\GI10483-PA 386 GI10483-PA 55..227 47..218 210 31 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:54:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11030-PA 191 GL11030-PA 1..191 109..299 881 87.4 Plus
Dper\GL16995-PA 296 GL16995-PA 73..296 69..299 328 35.6 Plus
Dper\GL13079-PA 319 GL13079-PA 62..269 52..250 238 32.6 Plus
Dper\GL13773-PA 302 GL13773-PA 3..235 21..266 221 29.7 Plus
Dper\GL19219-PA 787 GL19219-PA 25..237 7..218 217 35.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:54:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21314-PA 298 GA21314-PA 3..298 4..299 1294 82.4 Plus
Dpse\GA19673-PB 296 GA19673-PB 22..296 17..299 398 34.4 Plus
Dpse\GA19673-PA 296 GA19673-PA 22..296 17..299 398 34.4 Plus
Dpse\GA21887-PA 319 GA21887-PA 62..269 52..250 238 32.6 Plus
Dpse\GA19005-PB 325 GA19005-PB 24..258 19..266 229 29.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:54:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20345-PA 233 GM20345-PA 1..233 67..299 1197 99.1 Plus
Dsec\GM20252-PA 294 GM20252-PA 7..294 3..299 386 34.3 Plus
Dsec\GM16334-PA 326 GM16334-PA 24..289 19..288 234 30.9 Plus
Dsec\GM24034-PA 374 GM24034-PA 1..227 3..218 221 30.6 Plus
Dsec\GM23012-PA 312 GM23012-PA 55..262 52..250 216 30.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:54:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25824-PA 299 GD25824-PA 1..299 1..299 1523 98.7 Plus
Dsim\GD25738-PA 294 GD25738-PA 7..294 3..299 386 34.3 Plus
Dsim\GD18069-PA 318 GD18069-PA 16..251 19..266 230 31.6 Plus
Dsim\GD18835-PA 378 GD18835-PA 1..227 3..218 221 30.6 Plus
Dsim\GD22351-PA 783 GD22351-PA 33..233 19..218 218 36.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:54:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21004-PA 281 GJ21004-PA 14..281 32..299 1248 86.9 Plus
Dvir\GJ20693-PA 293 GJ20693-PA 7..293 3..299 390 33.8 Plus
Dvir\GJ15810-PA 313 GJ15810-PA 56..310 52..296 249 29.8 Plus
Dvir\GJ17917-PA 788 GJ17917-PA 25..238 7..218 227 37.3 Plus
Dvir\GJ23164-PA 385 GJ23164-PA 49..227 37..218 218 31.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:54:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15915-PA 302 GK15915-PA 1..302 1..299 1271 80.7 Plus
Dwil\GK17937-PA 295 GK17937-PA 22..295 17..299 392 34.5 Plus
Dwil\GK14405-PA 390 GK14405-PA 15..229 7..218 246 31 Plus
Dwil\GK25337-PA 317 GK25337-PA 60..314 52..296 237 28.2 Plus
Dwil\GK24255-PA 290 GK24255-PA 11..212 14..222 212 28.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:54:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13432-PA 299 GE13432-PA 1..299 1..299 1486 96 Plus
Dyak\GE13337-PA 294 GE13337-PA 7..294 3..299 389 34.3 Plus
Dyak\GE10552-PA 310 GE10552-PA 27..243 37..266 226 31.8 Plus
Dyak\GE10479-PA 783 GE10479-PA 33..233 19..218 224 36.3 Plus
Dyak\GE26195-PA 378 GE26195-PA 1..227 3..218 222 31.1 Plus