Clone SD20918 Report

Search the DGRC for SD20918

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:209
Well:18
Vector:pOT2
Associated Gene/TranscriptMED18-RA
Protein status:SD20918.pep: gold
Sequenced Size:843

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
MED-18-RA 2009-01-15 Manual selection by Sue Celniker

Clone Sequence Records

SD20918.complete Sequence

843 bp assembled on 2009-03-10

GenBank Submission: BT071807.1

> SD20918.complete
ATGAAACTAAAAACAAAACCAAACTACTGCTCAGTTAATTTAATACCATA
GTACACCCAAACTTACAAAATTAGCCAATGGCGATTGTGTCGTCGGCCCG
TGAGTCGCTCTCCCATGCGATGAACAACCGCTTCTTGCCCAACCTGGAGT
ACTTGCTGCAGGGATCTATCCTGGATTCCGCCGTGGAACACTTGATGCAC
AGACTAAAGGGACTCTGCGACAATGTGGACACCTCGCCGGAGCCGTTTCA
CGATCTGGAAGTGTGTATGAGCCTTCGCCAGCCCAATGCCAACCAGCCGC
TGCTTCTTCGCGTGCGCCGAGCCCTTGGTCGCGATGCACCCTTTCAGATG
CGCTACCTAGGAAACCCCGAGGTGGATCTGCGCCGGCCTACATTGGTACG
CAGCTGCATGGACTGCGCCTGCACCAATGGCATTTTGGAATTCCTCACGG
AAATGGGCTTCCGCCTGGAGTTCGAGTACATAGCAAAGGGCTATATGTTC
CGCAAGGGGCGCATGAAGATTACCGTCTCCAAGCTCATTAAGATTGTGCC
CGGCAAGCAGCAGGACATGGCCAACGAGCCAATCTCACAAAGCTACATAG
TGGAACTCTCTGTGGTGGCGCCAACGGGGCAGGAGAATGTCGGCGAGGAA
ATGCGCGTGTTTGCCGAGCAACTAAAGCCACTCGTGCAGCTCGAGAAGAT
CGACTACAAGCGACTGGGCGGCATGCCGTAGTTTACAATAAAAGTGCACA
TCGCATTTATCCAACAGTTATTTAATTTCTTAAATGTAAGAAAATATACA
AATTTACAGAAAAGAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

SD20918.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:26:41
Subject Length Description Subject Range Query Range Score Percent Strand
MED18-RC 865 MED18-RC 251..865 200..814 3075 100 Plus
MED18.b 865 MED18.b 251..865 200..814 3075 100 Plus
MED18.a 928 MED18.a 48..537 1..490 2450 100 Plus
MED18.a 928 MED18.a 603..928 489..814 1630 100 Plus
MED18-RC 865 MED18-RC 29..235 1..207 1020 99.5 Plus
MED18.b 865 MED18.b 29..235 1..207 1020 99.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:20:07
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 1760405..1760730 489..814 1630 100 Plus
chrX 22417052 chrX 1760049..1760339 200..490 1455 100 Plus
chrX 22417052 chrX 1759780..1759981 1..202 1010 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:57:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:20:05
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1866562..1866889 489..816 1640 100 Plus
X 23542271 X 1866206..1866496 200..490 1455 100 Plus
X 23542271 X 1865937..1866138 1..202 1010 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:43:33
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 1874660..1874987 489..816 1640 100 Plus
X 23527363 X 1874304..1874594 200..490 1455 100 Plus
X 23527363 X 1874035..1874236 1..202 1010 100 Plus
Blast to na_te.dros performed 2019-03-16 05:20:06
Subject Length Description Subject Range Query Range Score Percent Strand
412 7567 412 412 7567bp 2351..2412 309..248 112 64.5 Minus

SD20918.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:20:59 Download gff for SD20918.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 1759780..1759981 1..202 100 -> Plus
chrX 1760052..1760338 203..489 100 -> Plus
chrX 1760406..1760730 490..814 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:52:28 Download gff for SD20918.complete
Subject Subject Range Query Range Percent Splice Strand
MED18-RA 1..654 78..731 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:40:03 Download gff for SD20918.complete
Subject Subject Range Query Range Percent Splice Strand
MED18-RA 1..654 78..731 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:55:11 Download gff for SD20918.complete
Subject Subject Range Query Range Percent Splice Strand
MED18-RA 1..654 78..731 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:00:52 Download gff for SD20918.complete
Subject Subject Range Query Range Percent Splice Strand
MED18-RA 1..654 78..731 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-03-10 16:17:01 Download gff for SD20918.complete
Subject Subject Range Query Range Percent Splice Strand
MED18-RA 29..839 1..811 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:40:03 Download gff for SD20918.complete
Subject Subject Range Query Range Percent Splice Strand
MED18-RA 29..842 1..814 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:55:11 Download gff for SD20918.complete
Subject Subject Range Query Range Percent Splice Strand
MED18-RA 29..842 1..814 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:00:52 Download gff for SD20918.complete
Subject Subject Range Query Range Percent Splice Strand
MED18-RA 29..842 1..814 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:20:59 Download gff for SD20918.complete
Subject Subject Range Query Range Percent Splice Strand
X 1865937..1866138 1..202 100 -> Plus
X 1866209..1866495 203..489 100 -> Plus
X 1866563..1866887 490..814 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:20:59 Download gff for SD20918.complete
Subject Subject Range Query Range Percent Splice Strand
X 1865937..1866138 1..202 100 -> Plus
X 1866209..1866495 203..489 100 -> Plus
X 1866563..1866887 490..814 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:20:59 Download gff for SD20918.complete
Subject Subject Range Query Range Percent Splice Strand
X 1865937..1866138 1..202 100 -> Plus
X 1866209..1866495 203..489 100 -> Plus
X 1866563..1866887 490..814 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:55:11 Download gff for SD20918.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 1759970..1760171 1..202 100 -> Plus
arm_X 1760242..1760528 203..489 100 -> Plus
arm_X 1760596..1760920 490..814 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:14:17 Download gff for SD20918.complete
Subject Subject Range Query Range Percent Splice Strand
X 1874035..1874236 1..202 100 -> Plus
X 1874307..1874593 203..489 100 -> Plus
X 1874661..1874985 490..814 100   Plus

SD20918.pep Sequence

Translation from 77 to 730

> SD20918.pep
MAIVSSARESLSHAMNNRFLPNLEYLLQGSILDSAVEHLMHRLKGLCDNV
DTSPEPFHDLEVCMSLRQPNANQPLLLRVRRALGRDAPFQMRYLGNPEVD
LRRPTLVRSCMDCACTNGILEFLTEMGFRLEFEYIAKGYMFRKGRMKITV
SKLIKIVPGKQQDMANEPISQSYIVELSVVAPTGQENVGEEMRVFAEQLK
PLVQLEKIDYKRLGGMP*

SD20918.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:14:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21201-PA 217 GF21201-PA 1..217 1..217 1093 93.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:14:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12884-PA 217 GG12884-PA 1..217 1..217 1146 99.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:14:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24653-PA 216 GH24653-PA 3..216 4..217 1069 93.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:22
Subject Length Description Subject Range Query Range Score Percent Strand
MED18-PA 217 CG14802-PA 1..217 1..217 1118 100 Plus
MED18-PC 50 CG14802-PC 1..43 1..43 206 97.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:14:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11081-PA 217 GI11081-PA 3..217 4..217 1036 90.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:14:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20340-PA 217 GL20340-PA 1..217 1..217 1112 95.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:14:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13258-PA 217 GA13258-PA 1..217 1..217 1109 95.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:14:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19171-PA 217 GM19171-PA 1..217 1..217 1146 99.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:14:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16392-PA 216 GJ16392-PA 3..216 4..217 1063 92.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:14:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10069-PA 219 GK10069-PA 3..219 1..217 1080 93.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:14:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16712-PA 217 GE16712-PA 1..217 1..217 1146 99.5 Plus

SD20918.hyp Sequence

Translation from 77 to 730

> SD20918.hyp
MAIVSSARESLSHAMNNRFLPNLEYLLQGSILDSAVEHLMHRLKGLCDNV
DTSPEPFHDLEVCMSLRQPNANQPLLLRVRRALGRDAPFQMRYLGNPEVD
LRRPTLVRSCMDCACTNGILEFLTEMGFRLEFEYIAKGYMFRKGRMKITV
SKLIKIVPGKQQDMANEPISQSYIVELSVVAPTGQENVGEEMRVFAEQLK
PLVQLEKIDYKRLGGMP*

SD20918.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:58:56
Subject Length Description Subject Range Query Range Score Percent Strand
MED18-PA 217 CG14802-PA 1..217 1..217 1118 100 Plus
MED18-PC 50 CG14802-PC 1..43 1..43 206 97.7 Plus