Clone SD21096 Report

Search the DGRC for SD21096

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:210
Well:96
Vector:pOT2
Associated Gene/TranscriptCG14544-RA
Protein status:SD21096.pep: gold
Preliminary Size:1012
Sequenced Size:1049

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14544 2002-01-01 Sim4 clustering to Release 2
CG14544 2002-05-18 Blastp of sequenced clone
CG14544 2003-01-01 Sim4 clustering to Release 3
CG14544 2008-04-29 Release 5.5 accounting
CG14544 2008-08-15 Release 5.9 accounting
CG14544 2008-12-18 5.12 accounting

Clone Sequence Records

SD21096.complete Sequence

1049 bp (1049 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119248

> SD21096.complete
TCCATCTCTATTGCTTAAACACGCGGCTATTTTGTAAATAAAAAAATCTT
CTTACGGTTTTTAACTAAAAACATGAGTTTTCTGAAACCCAAGACCCACA
TAGAAAAGGGCGATGTGGTCATCCTTTATTTGAGTGTCAGTTCCATGCAT
GCCATCGAAGCGGTGCCCGAAATAGTGAACAAAAAGGGCGAAACAATACC
GCATATTTTTCAGACCAATTATGGATCGCTAAAAGTTGAAAATATCATCG
GCGTGGAGTATGGTAGTAAAGTGGAGCTCTCCAAGGGCTGGGCCCATGTC
CTTCAGCCGACGCCGGAACTCTGGACACAAACACTGCCCCACCGCACACA
GATTATTTACACGCCGGATATTAGTATGATTATCCACCAGCTGGAGGTCC
GACCCGGTGCCGTGGTGGTTGAGTCGGGCACGGGATCGGGGTCTCTATCG
CATTACTTTCTAAGAGCACTGAAACCCACTGGCCACCTGCACACCTTCGA
TTTCCACGAAGCTCGAGCGGATCAGGCACGCGACGAGTTCCGGCGACATG
GTATCGCTGACTTCGTCACCGTCTATCACCGGGACGTTTGCAATCTGGGC
TTTGGTGCGGAACTGGACGGAAAGGCCGATGCGGTCTTCTTGGATCTGCC
CGCGCCCGATCTCGCTGTGCCGCACGCCTTCAAGGCGTTGAAGCTGTCCG
GAGGTCGTTTCTGTTCGTTTTCGCCCTGCATTGAGCAGTCGCAGCGCTGC
ATCCAAGAGCTAACCAAGCTGGGCTTCAACGAGATTGTTTCCTTGGAGGT
GCTGCAGCAGGAGAACGTGGTGAAGACGCGCACGCTGCCCGTCATCGATC
TTGAGTTCCTTAAATTGCCCAAAACCGATGAGACGACGGCGGCAACAAAT
GCCTTGGAGAGCAAGGCGCCAAAGGAGGTGAAGAAGTACCTGACCTCCAG
TAATCCCCAAACCCTGCCCGGTCACACGGGCTTCCTCACCTTCGCCACTT
TGCCACCAAATATACCCAAGGCCTGATGAATAAAAAAAAAAAAAAAAAA

SD21096.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:54:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG14544-RA 1179 CG14544-RA 65..1098 1..1034 5170 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:57:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 21882792..21883251 242..701 2270 99.6 Plus
chr3R 27901430 chr3R 21883925..21884256 700..1031 1630 99.4 Plus
chr3R 27901430 chr3R 21882496..21882736 1..241 1190 99.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:57:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:57:57
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26059803..26060262 242..701 2300 100 Plus
3R 32079331 3R 26060936..26061270 700..1034 1675 100 Plus
3R 32079331 3R 26059508..26059748 1..241 1205 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:13:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 25800634..25801093 242..701 2300 100 Plus
3R 31820162 3R 25801767..25802101 700..1034 1675 100 Plus
3R 31820162 3R 25800339..25800579 1..241 1205 100 Plus
Blast to na_te.dros performed on 2019-03-15 16:57:57 has no hits.

SD21096.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:59:01 Download gff for SD21096.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 21882496..21882736 1..241 99 -> Plus
chr3R 21882792..21883250 242..700 99 -> Plus
chr3R 21883926..21884256 701..1031 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:09:47 Download gff for SD21096.complete
Subject Subject Range Query Range Percent Splice Strand
CG14544-RA 1..954 73..1026 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:52:05 Download gff for SD21096.complete
Subject Subject Range Query Range Percent Splice Strand
CG14544-RA 1..954 73..1026 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:13:22 Download gff for SD21096.complete
Subject Subject Range Query Range Percent Splice Strand
CG14544-RA 1..954 73..1026 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:34:27 Download gff for SD21096.complete
Subject Subject Range Query Range Percent Splice Strand
CG14544-RA 1..954 73..1026 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:21:50 Download gff for SD21096.complete
Subject Subject Range Query Range Percent Splice Strand
CG14544-RA 1..954 73..1026 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:03:45 Download gff for SD21096.complete
Subject Subject Range Query Range Percent Splice Strand
CG14544-RA 1..1031 1..1031 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:52:05 Download gff for SD21096.complete
Subject Subject Range Query Range Percent Splice Strand
CG14544-RA 13..1043 1..1031 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:13:22 Download gff for SD21096.complete
Subject Subject Range Query Range Percent Splice Strand
CG14544-RA 13..1043 1..1031 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:34:27 Download gff for SD21096.complete
Subject Subject Range Query Range Percent Splice Strand
CG14544-RA 1..1031 1..1031 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:21:50 Download gff for SD21096.complete
Subject Subject Range Query Range Percent Splice Strand
CG14544-RA 13..1043 1..1031 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:59:01 Download gff for SD21096.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26059508..26059748 1..241 100 -> Plus
3R 26059803..26060261 242..700 100 -> Plus
3R 26060937..26061267 701..1031 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:59:01 Download gff for SD21096.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26059508..26059748 1..241 100 -> Plus
3R 26059803..26060261 242..700 100 -> Plus
3R 26060937..26061267 701..1031 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:59:01 Download gff for SD21096.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26059508..26059748 1..241 100 -> Plus
3R 26059803..26060261 242..700 100 -> Plus
3R 26060937..26061267 701..1031 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:13:22 Download gff for SD21096.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21885230..21885470 1..241 100 -> Plus
arm_3R 21885525..21885983 242..700 100 -> Plus
arm_3R 21886659..21886989 701..1031 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:16:03 Download gff for SD21096.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25800339..25800579 1..241 100 -> Plus
3R 25800634..25801092 242..700 100 -> Plus
3R 25801768..25802098 701..1031 100   Plus

SD21096.pep Sequence

Translation from 72 to 1025

> SD21096.pep
MSFLKPKTHIEKGDVVILYLSVSSMHAIEAVPEIVNKKGETIPHIFQTNY
GSLKVENIIGVEYGSKVELSKGWAHVLQPTPELWTQTLPHRTQIIYTPDI
SMIIHQLEVRPGAVVVESGTGSGSLSHYFLRALKPTGHLHTFDFHEARAD
QARDEFRRHGIADFVTVYHRDVCNLGFGAELDGKADAVFLDLPAPDLAVP
HAFKALKLSGGRFCSFSPCIEQSQRCIQELTKLGFNEIVSLEVLQQENVV
KTRTLPVIDLEFLKLPKTDETTAATNALESKAPKEVKKYLTSSNPQTLPG
HTGFLTFATLPPNIPKA*

SD21096.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:26:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18507-PA 315 GF18507-PA 1..315 1..317 1574 92.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:26:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11463-PA 317 GG11463-PA 1..317 1..317 1671 99.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:26:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19464-PA 316 GH19464-PA 1..316 1..317 1489 86.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:13:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG14544-PB 317 CG14544-PB 1..317 1..317 1651 100 Plus
CG14544-PA 317 CG14544-PA 1..317 1..317 1651 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:26:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24698-PA 316 GI24698-PA 1..316 1..317 1491 87.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:26:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21827-PA 319 GL21827-PA 1..319 1..317 1562 90.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:26:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13069-PA 319 GA13069-PA 1..319 1..317 1561 90.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:26:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10305-PA 317 GM10305-PA 1..317 1..317 1671 99.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:26:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21268-PA 317 GD21268-PA 1..317 1..317 1676 99.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:26:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23914-PA 316 GJ23914-PA 1..316 1..317 1484 86.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:26:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14465-PA 314 GK14465-PA 1..314 1..316 1490 87.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:26:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23655-PA 319 GE23655-PA 1..319 1..317 1644 97.5 Plus

SD21096.hyp Sequence

Translation from 72 to 1025

> SD21096.hyp
MSFLKPKTHIEKGDVVILYLSVSSMHAIEAVPEIVNKKGETIPHIFQTNY
GSLKVENIIGVEYGSKVELSKGWAHVLQPTPELWTQTLPHRTQIIYTPDI
SMIIHQLEVRPGAVVVESGTGSGSLSHYFLRALKPTGHLHTFDFHEARAD
QARDEFRRHGIADFVTVYHRDVCNLGFGAELDGKADAVFLDLPAPDLAVP
HAFKALKLSGGRFCSFSPCIEQSQRCIQELTKLGFNEIVSLEVLQQENVV
KTRTLPVIDLEFLKLPKTDETTAATNALESKAPKEVKKYLTSSNPQTLPG
HTGFLTFATLPPNIPKA*

SD21096.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:08:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG14544-PB 317 CG14544-PB 1..317 1..317 1651 100 Plus
CG14544-PA 317 CG14544-PA 1..317 1..317 1651 100 Plus