BDGP Sequence Production Resources |
Search the DGRC for SD21317
Library: | SD |
Tissue Source: | Drosophila melanogaster Schneider L2 cell culture |
Created by: | Ling Hong |
Date Registered: | 1999-02-25 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 213 |
Well: | 17 |
Vector: | pOT2 |
Associated Gene/Transcript | RpS15-RB |
Protein status: | SD21317.pep: gold |
Sequenced Size: | 714 |
Gene | Date | Evidence |
---|---|---|
RpS15-RB | 2009-06-22 | Replacement based on scoring |
714 bp assembled on 2009-08-12
GenBank Submission: BT099560.1
> SD21317.complete AAAAAGATGGCCGATGTAAATATCTATACAAAAATCCAATGAAAAACTCG GCATCCGTGCGGGTATCGAACAAAATGCCATACGAAACACCATTAGAAGA CTTCGTTGCACGGCTGCTGATGTTATTCTGGAGTTTCGCAGCGCGATTTA CCGGCTAAATGGAAACTAATGTCGGTGTTTTTTTCGTTCTATGCAGCAAG TCGATGAAAATCTGAAGAAGAAGCGTACCTTCAAGAAGTTCACCTACCGC GGTGTCGACTTGGACCAGCTTCTGGACATGCCCAACAACCAGCTGGTGGA GCTGATGCACAGCCGTGCCCGCAGGCGTTTCTCCCGCGGACTGAAGCGCA AGCCAATGGCTCTGATCAAGAAGCTGCGCAAGGCCAAGAAGGAGGCACCG CCAAATGAGAAGCCCGAGATTGTCAAGACCCACCTGAGGAACATGATCAT CGTACCCGAGATGACCGGCTCCATCATTGGCGTCTACAACGGCAAGGACT TCGGACAGGTGGAGGTCAAGCCCGAGATGATCGGTCACTACCTGGGCGAG TTCGCCCTGACCTACAAGCCCGTCAAGCACGGTCGTCCTGGTATCGGTGC CACCCACAGCTCCCGTTTCATTCCTCTGAAGTGAGCGCTGCTCGTCTTTT GGGCTGTTGAGATGAATGATGCGTGAATAAATGAAACGTACTTTTATAAA AAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 12458152..12458437 | 285..1 | 1365 | 99.3 | Minus |
chr2R | 21145070 | chr2R | 12457859..12458083 | 510..286 | 1125 | 100 | Minus |
chr2R | 21145070 | chr2R | 12457431..12457623 | 697..505 | 965 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 16570917..16571203 | 285..1 | 1320 | 99 | Minus |
2R | 25286936 | 2R | 16570624..16570848 | 510..286 | 1125 | 100 | Minus |
2R | 25286936 | 2R | 16570194..16570388 | 699..505 | 975 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 16572116..16572402 | 285..1 | 1340 | 98.9 | Minus |
2R | 25260384 | 2R | 16571823..16572047 | 510..286 | 1125 | 100 | Minus |
2R | 25260384 | 2R | 16571393..16571587 | 699..505 | 975 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 12457431..12457619 | 509..697 | 100 | <- | Minus |
chr2R | 12457861..12458083 | 286..508 | 100 | <- | Minus |
chr2R | 12458152..12458437 | 1..285 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS15-RB | 1..444 | 191..634 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS15-RB | 1..444 | 191..634 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS15-RB | 1..444 | 191..634 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS15-RB | 1..444 | 191..634 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS15-RB | 3..701 | 1..697 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS15-RB | 3..701 | 1..697 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS15-RB | 28..726 | 1..697 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS15-RB | 28..726 | 1..697 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 16570917..16571203 | 1..285 | 98 | Minus | |
2R | 16570196..16570384 | 509..697 | 100 | <- | Minus |
2R | 16570626..16570848 | 286..508 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 16570917..16571203 | 1..285 | 98 | Minus | |
2R | 16570196..16570384 | 509..697 | 100 | <- | Minus |
2R | 16570626..16570848 | 286..508 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 16570917..16571203 | 1..285 | 98 | Minus | |
2R | 16570196..16570384 | 509..697 | 100 | <- | Minus |
2R | 16570626..16570848 | 286..508 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 12457701..12457889 | 509..697 | 100 | <- | Minus |
arm_2R | 12458131..12458353 | 286..508 | 100 | <- | Minus |
arm_2R | 12458422..12458708 | 1..285 | 98 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 16571825..16572047 | 286..508 | 100 | <- | Minus |
2R | 16572116..16572402 | 1..285 | 98 | Minus | |
2R | 16571395..16571583 | 509..697 | 100 | <- | Minus |
Translation from 190 to 633
> SD21317.pep MQQVDENLKKKRTFKKFTYRGVDLDQLLDMPNNQLVELMHSRARRRFSRG LKRKPMALIKKLRKAKKEAPPNEKPEIVKTHLRNMIIVPEMTGSIIGVYN GKDFGQVEVKPEMIGHYLGEFALTYKPVKHGRPGIGATHSSRFIPLK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF11258-PA | 148 | GF11258-PA | 4..148 | 3..147 | 758 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22261-PA | 148 | GG22261-PA | 4..148 | 3..147 | 758 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH20641-PA | 148 | GH20641-PA | 4..148 | 3..147 | 753 | 99.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpS15-PB | 147 | CG8332-PB | 1..147 | 1..147 | 764 | 100 | Plus |
RpS15-PA | 148 | CG8332-PA | 4..148 | 3..147 | 754 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI19004-PA | 148 | GI19004-PA | 4..148 | 3..147 | 753 | 99.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11338-PA | 148 | GL11338-PA | 3..148 | 2..147 | 750 | 97.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA20995-PA | 148 | GA20995-PA | 3..148 | 2..147 | 750 | 97.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM20051-PA | 148 | GM20051-PA | 4..148 | 3..147 | 755 | 99.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD25532-PA | 148 | GD25532-PA | 4..148 | 3..147 | 755 | 99.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ19970-PA | 148 | GJ19970-PA | 4..148 | 3..147 | 753 | 99.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK21598-PA | 145 | GK21598-PA | 2..145 | 4..147 | 732 | 97.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE14054-PA | 148 | GE14054-PA | 4..148 | 3..147 | 758 | 100 | Plus |
Translation from 190 to 633
> SD21317.hyp MQQVDENLKKKRTFKKFTYRGVDLDQLLDMPNNQLVELMHSRARRRFSRG LKRKPMALIKKLRKAKKEAPPNEKPEIVKTHLRNMIIVPEMTGSIIGVYN GKDFGQVEVKPEMIGHYLGEFALTYKPVKHGRPGIGATHSSRFIPLK*