Clone SD21317 Report

Search the DGRC for SD21317

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:213
Well:17
Vector:pOT2
Associated Gene/TranscriptRpS15-RB
Protein status:SD21317.pep: gold
Sequenced Size:714

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
RpS15-RB 2009-06-22 Replacement based on scoring

Clone Sequence Records

SD21317.complete Sequence

714 bp assembled on 2009-08-12

GenBank Submission: BT099560.1

> SD21317.complete
AAAAAGATGGCCGATGTAAATATCTATACAAAAATCCAATGAAAAACTCG
GCATCCGTGCGGGTATCGAACAAAATGCCATACGAAACACCATTAGAAGA
CTTCGTTGCACGGCTGCTGATGTTATTCTGGAGTTTCGCAGCGCGATTTA
CCGGCTAAATGGAAACTAATGTCGGTGTTTTTTTCGTTCTATGCAGCAAG
TCGATGAAAATCTGAAGAAGAAGCGTACCTTCAAGAAGTTCACCTACCGC
GGTGTCGACTTGGACCAGCTTCTGGACATGCCCAACAACCAGCTGGTGGA
GCTGATGCACAGCCGTGCCCGCAGGCGTTTCTCCCGCGGACTGAAGCGCA
AGCCAATGGCTCTGATCAAGAAGCTGCGCAAGGCCAAGAAGGAGGCACCG
CCAAATGAGAAGCCCGAGATTGTCAAGACCCACCTGAGGAACATGATCAT
CGTACCCGAGATGACCGGCTCCATCATTGGCGTCTACAACGGCAAGGACT
TCGGACAGGTGGAGGTCAAGCCCGAGATGATCGGTCACTACCTGGGCGAG
TTCGCCCTGACCTACAAGCCCGTCAAGCACGGTCGTCCTGGTATCGGTGC
CACCCACAGCTCCCGTTTCATTCCTCTGAAGTGAGCGCTGCTCGTCTTTT
GGGCTGTTGAGATGAATGATGCGTGAATAAATGAAACGTACTTTTATAAA
AAAAAAAAAAAAAA

SD21317.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:30:20
Subject Length Description Subject Range Query Range Score Percent Strand
RpS15-RB 900 RpS15-RB 72..772 1..699 3410 99.5 Plus
RpS15-RA 728 RpS15-RA 98..600 197..699 2515 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:13:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12458152..12458437 285..1 1365 99.3 Minus
chr2R 21145070 chr2R 12457859..12458083 510..286 1125 100 Minus
chr2R 21145070 chr2R 12457431..12457623 697..505 965 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:57:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:13:00
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16570917..16571203 285..1 1320 99 Minus
2R 25286936 2R 16570624..16570848 510..286 1125 100 Minus
2R 25286936 2R 16570194..16570388 699..505 975 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:26:07
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16572116..16572402 285..1 1340 98.9 Minus
2R 25260384 2R 16571823..16572047 510..286 1125 100 Minus
2R 25260384 2R 16571393..16571587 699..505 975 100 Minus
Blast to na_te.dros performed on 2019-03-16 18:13:00 has no hits.

SD21317.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:13:46 Download gff for SD21317.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12457431..12457619 509..697 100 <- Minus
chr2R 12457861..12458083 286..508 100 <- Minus
chr2R 12458152..12458437 1..285 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:13:47 Download gff for SD21317.complete
Subject Subject Range Query Range Percent Splice Strand
RpS15-RB 1..444 191..634 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:58:09 Download gff for SD21317.complete
Subject Subject Range Query Range Percent Splice Strand
RpS15-RB 1..444 191..634 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:17:13 Download gff for SD21317.complete
Subject Subject Range Query Range Percent Splice Strand
RpS15-RB 1..444 191..634 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:34:02 Download gff for SD21317.complete
Subject Subject Range Query Range Percent Splice Strand
RpS15-RB 1..444 191..634 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-08-12 16:15:14 Download gff for SD21317.complete
Subject Subject Range Query Range Percent Splice Strand
RpS15-RB 3..701 1..697 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:58:08 Download gff for SD21317.complete
Subject Subject Range Query Range Percent Splice Strand
RpS15-RB 3..701 1..697 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:17:13 Download gff for SD21317.complete
Subject Subject Range Query Range Percent Splice Strand
RpS15-RB 28..726 1..697 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:34:02 Download gff for SD21317.complete
Subject Subject Range Query Range Percent Splice Strand
RpS15-RB 28..726 1..697 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:13:46 Download gff for SD21317.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16570917..16571203 1..285 98   Minus
2R 16570196..16570384 509..697 100 <- Minus
2R 16570626..16570848 286..508 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:13:46 Download gff for SD21317.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16570917..16571203 1..285 98   Minus
2R 16570196..16570384 509..697 100 <- Minus
2R 16570626..16570848 286..508 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:13:46 Download gff for SD21317.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16570917..16571203 1..285 98   Minus
2R 16570196..16570384 509..697 100 <- Minus
2R 16570626..16570848 286..508 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:17:13 Download gff for SD21317.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12457701..12457889 509..697 100 <- Minus
arm_2R 12458131..12458353 286..508 100 <- Minus
arm_2R 12458422..12458708 1..285 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:49:46 Download gff for SD21317.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16571825..16572047 286..508 100 <- Minus
2R 16572116..16572402 1..285 98   Minus
2R 16571395..16571583 509..697 100 <- Minus

SD21317.pep Sequence

Translation from 190 to 633

> SD21317.pep
MQQVDENLKKKRTFKKFTYRGVDLDQLLDMPNNQLVELMHSRARRRFSRG
LKRKPMALIKKLRKAKKEAPPNEKPEIVKTHLRNMIIVPEMTGSIIGVYN
GKDFGQVEVKPEMIGHYLGEFALTYKPVKHGRPGIGATHSSRFIPLK*

SD21317.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:52:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11258-PA 148 GF11258-PA 4..148 3..147 758 100 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:52:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22261-PA 148 GG22261-PA 4..148 3..147 758 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:52:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20641-PA 148 GH20641-PA 4..148 3..147 753 99.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:20:05
Subject Length Description Subject Range Query Range Score Percent Strand
RpS15-PB 147 CG8332-PB 1..147 1..147 764 100 Plus
RpS15-PA 148 CG8332-PA 4..148 3..147 754 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:52:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19004-PA 148 GI19004-PA 4..148 3..147 753 99.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:52:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11338-PA 148 GL11338-PA 3..148 2..147 750 97.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:52:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20995-PA 148 GA20995-PA 3..148 2..147 750 97.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:52:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20051-PA 148 GM20051-PA 4..148 3..147 755 99.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:52:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25532-PA 148 GD25532-PA 4..148 3..147 755 99.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:52:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19970-PA 148 GJ19970-PA 4..148 3..147 753 99.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:52:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21598-PA 145 GK21598-PA 2..145 4..147 732 97.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:52:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14054-PA 148 GE14054-PA 4..148 3..147 758 100 Plus

SD21317.hyp Sequence

Translation from 190 to 633

> SD21317.hyp
MQQVDENLKKKRTFKKFTYRGVDLDQLLDMPNNQLVELMHSRARRRFSRG
LKRKPMALIKKLRKAKKEAPPNEKPEIVKTHLRNMIIVPEMTGSIIGVYN
GKDFGQVEVKPEMIGHYLGEFALTYKPVKHGRPGIGATHSSRFIPLK*

SD21317.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:41:32
Subject Length Description Subject Range Query Range Score Percent Strand
RpS15-PB 147 CG8332-PB 1..147 1..147 764 100 Plus
RpS15-PA 148 CG8332-PA 4..148 3..147 754 100 Plus