Clone SD22308 Report

Search the DGRC for SD22308

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:223
Well:8
Vector:pOT2
Associated Gene/TranscriptCG15209-RA
Protein status:SD22308.pep: gold
Preliminary Size:525
Sequenced Size:860

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15209 2002-01-01 Sim4 clustering to Release 2
CG15209 2002-05-18 Blastp of sequenced clone
CG15209 2003-01-01 Sim4 clustering to Release 3
CG15209 2008-04-29 Release 5.5 accounting
CG15209 2008-08-15 Release 5.9 accounting
CG15209 2008-12-18 5.12 accounting

Clone Sequence Records

SD22308.complete Sequence

860 bp (860 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119254

> SD22308.complete
ACCCCGAGAGTCGAGTCCAGGCCACGATCGATCGACATGCGACAGGCGGG
CAGCAGTGCCACAGCAAAGCTACTAGCAGTCGGACGTAAACATGAAACCC
ATTGGGTGCAACAATATTCCGGTCATCTTCCTGGTGATCCTCGGCATGGT
CAGCCTGGCCAATTCGCTGCCCATGAATCCCGAACAGGAGCTAAAAGATG
TCGACGAGCCATTGGGTCAGCAACGTCAGCATAAACAGCAGCATGTGCAG
CAGATGCAGCGCATGGTGAAGAGCGAAGCGGTGCCAGAGTCGGAGTTCGT
CGGAAAAATTGCGCCACGCAATGAGCAGAATCCGGAGGATGAATACGATG
CCGTCACATTGGTGGAGGAGCTAGAGGCCGCCGGAGTTAAGCTGGCCGAT
CGACGTGATCTGCGCAAGCTAACCTACACGGAGCTGGCCCGCCTGCTAGC
CCTATGGCATCTGTCCCAGAATCGCAATGTTTACAATGCCAAAGGACCGG
AGGAGCAGCCCAATCAGGCCATCGATGAGCGTTAATTTAGTTGCTTAATG
AGTAAGCTCGTTTATTTAAAGCCAAAGTTCACTTAATATATATACATATA
TATATATATATATATTTTGTGTGACAAGAGAAAAAGGCTAGTAGTACGCT
CCACGGAGAACGAAGTGGGATGACCCATGCAGATATACATACTATGGCAA
CTATATGATATTCTCCGACCTGACTTTCGTTAGAACATTATAAGGAGCAT
TGTAGTTCCAGCAGCAATTCTTTCAAATAATAGTTTGCCTCATTTTTAGA
CTCGTATAGAAATGCAAATAAACTAAACCGTATTATTGTAAAAAAAAAAA
AAAAAAAAAA

SD22308.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:00:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG15209-RA 841 CG15209-RA 1..841 1..839 4120 99.5 Plus
CG32669-RA 2385 CG32669-RA 2086..2385 840..543 1415 98.6 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:36:17
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 10733449..10734289 1..839 4140 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:57:41 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:36:15
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 10842155..10842996 1..840 4115 99.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:32:00
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 10850253..10851094 1..840 4125 99.5 Plus
Blast to na_te.dros performed 2019-03-16 00:36:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2349..2391 218..260 116 74.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6854..6889 218..253 108 77.8 Plus

SD22308.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:37:08 Download gff for SD22308.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 10733449..10734289 1..839 96   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:10:03 Download gff for SD22308.complete
Subject Subject Range Query Range Percent Splice Strand
CG15209-RA 1..444 92..535 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:40:03 Download gff for SD22308.complete
Subject Subject Range Query Range Percent Splice Strand
CG15209-RA 1..444 92..535 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:54:54 Download gff for SD22308.complete
Subject Subject Range Query Range Percent Splice Strand
CG15209-RA 1..444 92..535 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:31:49 Download gff for SD22308.complete
Subject Subject Range Query Range Percent Splice Strand
CG15209-RA 1..444 92..535 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:06:58 Download gff for SD22308.complete
Subject Subject Range Query Range Percent Splice Strand
CG15209-RA 1..444 92..535 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:13:25 Download gff for SD22308.complete
Subject Subject Range Query Range Percent Splice Strand
CG15209-RA 1..841 1..839 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:40:02 Download gff for SD22308.complete
Subject Subject Range Query Range Percent Splice Strand
CG15209-RA 1..841 1..839 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:54:54 Download gff for SD22308.complete
Subject Subject Range Query Range Percent Splice Strand
CG15209-RA 1..841 1..839 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:31:49 Download gff for SD22308.complete
Subject Subject Range Query Range Percent Splice Strand
CG15209-RA 1..841 1..839 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:06:58 Download gff for SD22308.complete
Subject Subject Range Query Range Percent Splice Strand
CG15209-RA 1..791 51..839 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:37:08 Download gff for SD22308.complete
Subject Subject Range Query Range Percent Splice Strand
X 10842155..10842995 1..839 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:37:08 Download gff for SD22308.complete
Subject Subject Range Query Range Percent Splice Strand
X 10842155..10842995 1..839 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:37:08 Download gff for SD22308.complete
Subject Subject Range Query Range Percent Splice Strand
X 10842155..10842995 1..839 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:54:54 Download gff for SD22308.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 10736188..10737028 1..839 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:04:22 Download gff for SD22308.complete
Subject Subject Range Query Range Percent Splice Strand
X 10850253..10851093 1..839 99   Plus

SD22308.hyp Sequence

Translation from 91 to 534

> SD22308.hyp
MKPIGCNNIPVIFLVILGMVSLANSLPMNPEQELKDVDEPLGQQRQHKQQ
HVQQMQRMVKSEAVPESEFVGKIAPRNEQNPEDEYDAVTLVEELEAAGVK
LADRRDLRKLTYTELARLLALWHLSQNRNVYNAKGPEEQPNQAIDER*

SD22308.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:29:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG15209-PA 147 CG15209-PA 1..147 1..147 755 100 Plus

SD22308.pep Sequence

Translation from 91 to 534

> SD22308.pep
MKPIGCNNIPVIFLVILGMVSLANSLPMNPEQELKDVDEPLGQQRQHKQQ
HVQQMQRMVKSEAVPESEFVGKIAPRNEQNPEDEYDAVTLVEELEAAGVK
LADRRDLRKLTYTELARLLALWHLSQNRNVYNAKGPEEQPNQAIDER*

SD22308.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:10:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19980-PA 146 GF19980-PA 21..125 20..131 224 48.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:10:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18371-PA 150 GG18371-PA 1..149 1..146 556 79.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 04:10:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12655-PA 138 GH12655-PA 1..113 1..133 174 36.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:09:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG15209-PA 147 CG15209-PA 1..147 1..147 755 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 04:10:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14827-PA 137 GI14827-PA 24..120 27..133 158 38.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:10:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13571-PA 127 GA13571-PA 54..124 70..137 160 49.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:10:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11436-PA 148 GM11436-PA 1..148 1..147 620 89.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:10:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16989-PA 148 GD16989-PA 1..148 1..147 623 90 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:10:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19492-PA 135 GJ19492-PA 1..115 1..135 181 36.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:10:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16452-PA 135 GK16452-PA 8..128 9..135 177 37.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:10:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17860-PA 145 GE17860-PA 1..145 1..147 552 80.9 Plus