BDGP Sequence Production Resources |
Search the DGRC for SD22308
Library: | SD |
Tissue Source: | Drosophila melanogaster Schneider L2 cell culture |
Created by: | Ling Hong |
Date Registered: | 1999-02-25 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 223 |
Well: | 8 |
Vector: | pOT2 |
Associated Gene/Transcript | CG15209-RA |
Protein status: | SD22308.pep: gold |
Preliminary Size: | 525 |
Sequenced Size: | 860 |
Gene | Date | Evidence |
---|---|---|
CG15209 | 2002-01-01 | Sim4 clustering to Release 2 |
CG15209 | 2002-05-18 | Blastp of sequenced clone |
CG15209 | 2003-01-01 | Sim4 clustering to Release 3 |
CG15209 | 2008-04-29 | Release 5.5 accounting |
CG15209 | 2008-08-15 | Release 5.9 accounting |
CG15209 | 2008-12-18 | 5.12 accounting |
860 bp (860 high quality bases) assembled on 2002-05-18
GenBank Submission: AY119254
> SD22308.complete ACCCCGAGAGTCGAGTCCAGGCCACGATCGATCGACATGCGACAGGCGGG CAGCAGTGCCACAGCAAAGCTACTAGCAGTCGGACGTAAACATGAAACCC ATTGGGTGCAACAATATTCCGGTCATCTTCCTGGTGATCCTCGGCATGGT CAGCCTGGCCAATTCGCTGCCCATGAATCCCGAACAGGAGCTAAAAGATG TCGACGAGCCATTGGGTCAGCAACGTCAGCATAAACAGCAGCATGTGCAG CAGATGCAGCGCATGGTGAAGAGCGAAGCGGTGCCAGAGTCGGAGTTCGT CGGAAAAATTGCGCCACGCAATGAGCAGAATCCGGAGGATGAATACGATG CCGTCACATTGGTGGAGGAGCTAGAGGCCGCCGGAGTTAAGCTGGCCGAT CGACGTGATCTGCGCAAGCTAACCTACACGGAGCTGGCCCGCCTGCTAGC CCTATGGCATCTGTCCCAGAATCGCAATGTTTACAATGCCAAAGGACCGG AGGAGCAGCCCAATCAGGCCATCGATGAGCGTTAATTTAGTTGCTTAATG AGTAAGCTCGTTTATTTAAAGCCAAAGTTCACTTAATATATATACATATA TATATATATATATATTTTGTGTGACAAGAGAAAAAGGCTAGTAGTACGCT CCACGGAGAACGAAGTGGGATGACCCATGCAGATATACATACTATGGCAA CTATATGATATTCTCCGACCTGACTTTCGTTAGAACATTATAAGGAGCAT TGTAGTTCCAGCAGCAATTCTTTCAAATAATAGTTTGCCTCATTTTTAGA CTCGTATAGAAATGCAAATAAACTAAACCGTATTATTGTAAAAAAAAAAA AAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chrX | 22417052 | chrX | 10733449..10734289 | 1..839 | 4140 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23542271 | X | 10842155..10842996 | 1..840 | 4115 | 99.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23527363 | X | 10850253..10851094 | 1..840 | 4125 | 99.5 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 10733449..10734289 | 1..839 | 96 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15209-RA | 1..444 | 92..535 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15209-RA | 1..444 | 92..535 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15209-RA | 1..444 | 92..535 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15209-RA | 1..444 | 92..535 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15209-RA | 1..444 | 92..535 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15209-RA | 1..841 | 1..839 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15209-RA | 1..841 | 1..839 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15209-RA | 1..841 | 1..839 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15209-RA | 1..841 | 1..839 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15209-RA | 1..791 | 51..839 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 10842155..10842995 | 1..839 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 10842155..10842995 | 1..839 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 10842155..10842995 | 1..839 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 10736188..10737028 | 1..839 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 10850253..10851093 | 1..839 | 99 | Plus |
Translation from 91 to 534
> SD22308.hyp MKPIGCNNIPVIFLVILGMVSLANSLPMNPEQELKDVDEPLGQQRQHKQQ HVQQMQRMVKSEAVPESEFVGKIAPRNEQNPEDEYDAVTLVEELEAAGVK LADRRDLRKLTYTELARLLALWHLSQNRNVYNAKGPEEQPNQAIDER*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15209-PA | 147 | CG15209-PA | 1..147 | 1..147 | 755 | 100 | Plus |
Translation from 91 to 534
> SD22308.pep MKPIGCNNIPVIFLVILGMVSLANSLPMNPEQELKDVDEPLGQQRQHKQQ HVQQMQRMVKSEAVPESEFVGKIAPRNEQNPEDEYDAVTLVEELEAAGVK LADRRDLRKLTYTELARLLALWHLSQNRNVYNAKGPEEQPNQAIDER*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF19980-PA | 146 | GF19980-PA | 21..125 | 20..131 | 224 | 48.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG18371-PA | 150 | GG18371-PA | 1..149 | 1..146 | 556 | 79.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH12655-PA | 138 | GH12655-PA | 1..113 | 1..133 | 174 | 36.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15209-PA | 147 | CG15209-PA | 1..147 | 1..147 | 755 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI14827-PA | 137 | GI14827-PA | 24..120 | 27..133 | 158 | 38.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13571-PA | 127 | GA13571-PA | 54..124 | 70..137 | 160 | 49.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM11436-PA | 148 | GM11436-PA | 1..148 | 1..147 | 620 | 89.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD16989-PA | 148 | GD16989-PA | 1..148 | 1..147 | 623 | 90 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ19492-PA | 135 | GJ19492-PA | 1..115 | 1..135 | 181 | 36.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK16452-PA | 135 | GK16452-PA | 8..128 | 9..135 | 177 | 37.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE17860-PA | 145 | GE17860-PA | 1..145 | 1..147 | 552 | 80.9 | Plus |