Clone SD22430 Report

Search the DGRC for SD22430

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:224
Well:30
Vector:pOT2
Associated Gene/TranscriptCG4259-RA
Protein status:SD22430.pep: gold
Preliminary Size:756
Sequenced Size:978

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4259 2002-01-01 Sim4 clustering to Release 2
CG4259 2002-05-18 Blastp of sequenced clone
CG4259 2003-01-01 Sim4 clustering to Release 3
CG4259 2008-04-29 Release 5.5 accounting
CG4259 2008-08-15 Release 5.9 accounting
CG4259 2008-12-18 5.12 accounting

Clone Sequence Records

SD22430.complete Sequence

978 bp (978 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119256

> SD22430.complete
CGGAATGTCGCTATACTTTGCGTTTCTCACGACACTGATAATCAGCCTTG
TGAATAGTCAATACTTTAACTACAATCAGATACGACGTGAAACATATGGC
AGTAATCCCAGAGCGACATTTCCCTGGGTGGTTTCTGTGCTCGACCAGAG
GGATTGGCTGTTTCGCTATATAGGAGTGGGATCTCTGATTAATCCAAATG
TGGTCCTTACTGCCGCTCATATTCTGAATGGAACAACCAAGTATGATCTG
GTGGTGCGAGCTGGCGAATGGGATACCTCGACTACGGCTGACCAGCAGCA
CGTGGATCTCGAGGTGCTGAATATAGTCTCCCATGAACAGTTCAACAGAT
TCAATGCCGAAAACAACATGGCGTTACTCATTCTGGTATCCGCATTTGAG
ATGACAGCCAACATTAATTTAATCCCATTGTACCTACAAGAAGCTGGTAT
TCAAAAAGGATCCTGCTTCTTCAACGGCTGGGGAAAAGTATATTTGAACT
CGACGGACTACCCCACCGTTCTCAAGACGGTCCAGGTCGATCTTTTGAGC
ATGGGTATGTGTAGCTCTCGAAAGCTGCCCATCCAGCAAATCTGTGGGAA
AGGTCTGGAAGGCATAGATTGCAGTGGAGACGGTGGGGCTCCTCTGGTTT
GTCGGATACTTACATATCCATATAAGTACGCACAGGTGGGCATTGTGAAC
TGGTTAAGTCAAAAGCCTGTCGAAAATACATTCATCGTCTTTACGAATGT
AGCTGGTCTGCTCCCTTGGATTGACTACCATTTAAGACTTGAAGCGAACT
TTCGTCCCAGAAGTTGAAAACTAAAGCCTTAGGCAGTTAGCCAGTTATTT
ATTAAATCTTTATTCGGAGAATCAGAAAAGAGAGCAAATAGTTATCTGCA
GTTATTTCCTAAATAAAATGTGGCCTGTGTCCAATCACAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAA

SD22430.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:00:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG4259-RA 1003 CG4259-RA 35..975 1..941 4705 100 Plus
CG4259.b 1171 CG4259.b 35..975 1..941 4705 100 Plus
CG4259.a 1839 CG4259.a 35..975 1..941 4705 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:46:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 2127952..2128813 938..77 4280 99.8 Minus
chr2L 23010047 chr2L 2128872..2128950 79..1 380 98.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:57:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:46:11
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2128209..2129073 941..77 4325 100 Minus
2L 23513712 2L 2129133..2129211 79..1 395 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:32:01
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2128209..2129073 941..77 4325 100 Minus
2L 23513712 2L 2129133..2129211 79..1 395 100 Minus
Blast to na_te.dros performed on 2019-03-15 20:46:12 has no hits.

SD22430.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:47:03 Download gff for SD22430.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 2127952..2128810 80..938 99 <- Minus
chr2L 2128872..2128950 1..79 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:10:08 Download gff for SD22430.complete
Subject Subject Range Query Range Percent Splice Strand
CG4259-RA 1..813 5..817 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:40:05 Download gff for SD22430.complete
Subject Subject Range Query Range Percent Splice Strand
CG4259-RA 1..813 5..817 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:19:57 Download gff for SD22430.complete
Subject Subject Range Query Range Percent Splice Strand
CG4259-RA 1..813 5..817 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:31:51 Download gff for SD22430.complete
Subject Subject Range Query Range Percent Splice Strand
CG4259-RA 1..813 5..817 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:27:42 Download gff for SD22430.complete
Subject Subject Range Query Range Percent Splice Strand
CG4259-RA 1..813 5..817 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:13:28 Download gff for SD22430.complete
Subject Subject Range Query Range Percent Splice Strand
CG4259-RA 1..935 1..935 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:40:05 Download gff for SD22430.complete
Subject Subject Range Query Range Percent Splice Strand
CG4259-RA 1..935 1..935 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:19:57 Download gff for SD22430.complete
Subject Subject Range Query Range Percent Splice Strand
CG4259-RA 27..964 1..938 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:31:51 Download gff for SD22430.complete
Subject Subject Range Query Range Percent Splice Strand
CG4259-RA 1..935 1..935 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:27:42 Download gff for SD22430.complete
Subject Subject Range Query Range Percent Splice Strand
CG4259-RA 27..964 1..938 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:47:03 Download gff for SD22430.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2128212..2129070 80..938 100 <- Minus
2L 2129133..2129211 1..79 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:47:03 Download gff for SD22430.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2128212..2129070 80..938 100 <- Minus
2L 2129133..2129211 1..79 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:47:03 Download gff for SD22430.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2128212..2129070 80..938 100 <- Minus
2L 2129133..2129211 1..79 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:19:57 Download gff for SD22430.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2128212..2129070 80..938 100 <- Minus
arm_2L 2129133..2129211 1..79 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:04:25 Download gff for SD22430.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2128212..2129070 80..938 100 <- Minus
2L 2129133..2129211 1..79 100   Minus

SD22430.hyp Sequence

Translation from 0 to 816

> SD22430.hyp
GMSLYFAFLTTLIISLVNSQYFNYNQIRRETYGSNPRATFPWVVSVLDQR
DWLFRYIGVGSLINPNVVLTAAHILNGTTKYDLVVRAGEWDTSTTADQQH
VDLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGI
QKGSCFFNGWGKVYLNSTDYPTVLKTVQVDLLSMGMCSSRKLPIQQICGK
GLEGIDCSGDGGAPLVCRILTYPYKYAQVGIVNWLSQKPVENTFIVFTNV
AGLLPWIDYHLRLEANFRPRS*

SD22430.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:00:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG4259-PB 270 CG4259-PB 1..270 2..271 1424 100 Plus
CG4259-PA 270 CG4259-PA 1..270 2..271 1424 100 Plus
CG14990-PA 322 CG14990-PA 72..309 40..269 380 37.2 Plus
CG3117-PB 347 CG3117-PB 77..332 15..261 344 34.2 Plus
CG18478-PA 294 CG18478-PA 46..280 31..257 339 34.7 Plus

SD22430.pep Sequence

Translation from 4 to 816

> SD22430.pep
MSLYFAFLTTLIISLVNSQYFNYNQIRRETYGSNPRATFPWVVSVLDQRD
WLFRYIGVGSLINPNVVLTAAHILNGTTKYDLVVRAGEWDTSTTADQQHV
DLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGIQ
KGSCFFNGWGKVYLNSTDYPTVLKTVQVDLLSMGMCSSRKLPIQQICGKG
LEGIDCSGDGGAPLVCRILTYPYKYAQVGIVNWLSQKPVENTFIVFTNVA
GLLPWIDYHLRLEANFRPRS*

SD22430.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:10:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19694-PA 242 GF19694-PA 7..224 39..261 394 43.1 Plus
Dana\GF13730-PA 383 GF13730-PA 104..334 36..257 344 34.6 Plus
Dana\GF11134-PA 345 GF11134-PA 102..339 26..257 331 32.9 Plus
Dana\GF13091-PA 347 GF13091-PA 93..341 28..268 319 31.2 Plus
Dana\GF14116-PA 400 GF14116-PA 157..366 37..233 304 36.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:10:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24557-PA 280 GG24557-PA 1..280 1..270 911 64.2 Plus
Dere\GG23951-PA 413 GG23951-PA 165..403 37..262 349 35.6 Plus
Dere\GG25170-PA 442 GG25170-PA 112..341 36..256 340 36.2 Plus
Dere\GG24481-PA 341 GG24481-PA 95..329 39..265 327 32.8 Plus
Dere\GG23377-PA 447 GG23377-PA 199..433 37..257 301 32.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 04:10:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21265-PA 363 GH21265-PA 119..360 37..266 408 40.7 Plus
Dgri\GH13850-PA 400 GH13850-PA 152..390 37..262 345 37.8 Plus
Dgri\GH10384-PA 371 GH10384-PA 119..355 37..262 327 36.1 Plus
Dgri\GH11351-PA 299 GH11351-PA 41..287 18..260 311 32.3 Plus
Dgri\GH20539-PA 450 GH20539-PA 204..445 37..264 304 32 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG4259-PB 270 CG4259-PB 1..270 1..270 1424 100 Plus
CG4259-PA 270 CG4259-PA 1..270 1..270 1424 100 Plus
CG14990-PA 322 CG14990-PA 72..309 39..268 380 37.2 Plus
CG31780-PB 464 CG31780-PB 96..344 16..256 346 35.3 Plus
CG18477-PA 464 CG18477-PA 96..344 16..256 346 35.3 Plus
CG3117-PB 347 CG3117-PB 77..332 14..260 344 34.2 Plus
CG31827-PA 294 CG31827-PA 46..280 30..256 339 34.7 Plus
CG18478-PA 294 CG18478-PA 46..280 30..256 339 34.7 Plus
CG5390-PB 406 CG5390-PB 160..396 39..262 330 35.9 Plus
CG5390-PA 406 CG5390-PA 160..396 39..262 330 35.9 Plus
CG18557-PA 343 CG18557-PA 95..329 39..265 307 31.9 Plus
CG4793-PD 910 CG4793-PD 107..343 36..264 296 34.6 Plus
CG8738-PA 459 CG8738-PA 197..445 23..257 293 29.8 Plus
CG40160-PH 421 CG40160-PH 176..409 39..260 288 35 Plus
CG40160-PG 421 CG40160-PG 176..409 39..260 288 35 Plus
CG40160-PF 421 CG40160-PF 176..409 39..260 288 35 Plus
CG40160-PE 421 CG40160-PE 176..409 39..260 288 35 Plus
CG40160-PD 421 CG40160-PD 176..409 39..260 288 35 Plus
CG40160-PA 421 CG40160-PA 176..409 39..260 288 35 Plus
SPH93-PA 494 CG6639-PA 255..482 37..256 283 35.9 Plus
CG8586-PC 444 CG8586-PC 199..435 39..261 266 30.8 Plus
CG8586-PB 444 CG8586-PB 199..435 39..261 266 30.8 Plus
CG8586-PA 444 CG8586-PA 199..435 39..261 266 30.8 Plus
CG4998-PA 891 CG4998-PA 647..883 32..256 246 29.6 Plus
CG4998-PB 1185 CG4998-PB 941..1177 32..256 246 29.6 Plus
CG13318-PA 405 CG13318-PA 174..405 39..262 230 30.7 Plus
CG18563-PB 379 CG18563-PB 140..371 34..256 203 29.5 Plus
l(2)k05911-PC 639 CG31728-PC 411..634 39..256 196 28.6 Plus
CG8299-PA 260 CG8299-PA 37..253 37..257 186 27.5 Plus
CG32260-PC 395 CG32260-PC 156..392 36..260 184 28.3 Plus
CG32260-PA 575 CG32260-PA 336..572 36..260 184 28.3 Plus
betaTry-PB 253 CG18211-PB 40..249 37..256 183 27.9 Plus
betaTry-PA 253 CG18211-PA 40..249 37..256 183 27.9 Plus
alphaTry-PA 256 CG18444-PA 40..249 37..256 183 28.3 Plus
CG11836-PI 281 CG11836-PI 56..274 39..260 183 26.2 Plus
CG11836-PJ 333 CG11836-PJ 108..326 39..260 183 26.2 Plus
CG11836-PF 223 CG11836-PF 14..216 59..260 182 27.3 Plus
CG11836-PE 223 CG11836-PE 14..216 59..260 182 27.3 Plus
CG11836-PG 223 CG11836-PG 14..216 59..260 182 27.3 Plus
CG11836-PC 223 CG11836-PC 14..216 59..260 182 27.3 Plus
CG11836-PA 223 CG11836-PA 14..216 59..260 182 27.3 Plus
CG11836-PB 223 CG11836-PB 14..216 59..260 182 27.3 Plus
gammaTry-PA 253 CG30028-PA 40..249 37..256 180 27 Plus
CG30025-PA 253 CG30025-PA 40..249 37..256 180 27 Plus
deltaTry-PA 253 CG12351-PA 40..249 37..256 180 27 Plus
CG30031-PA 253 CG30031-PA 40..249 37..256 180 27 Plus
CG32755-PA 315 CG32755-PA 50..271 40..256 177 29.8 Plus
CG1299-PB 442 CG1299-PB 223..434 59..256 176 28.8 Plus
CG1299-PA 511 CG1299-PA 292..503 59..256 176 28.8 Plus
CG17571-PB 258 CG17571-PB 59..251 59..256 172 30.2 Plus
CG17571-PA 258 CG17571-PA 59..251 59..256 172 30.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 04:10:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19467-PA 398 GI19467-PA 150..388 37..262 358 36.4 Plus
Dmoj\GI24370-PA 420 GI24370-PA 175..408 39..260 321 36.3 Plus
Dmoj\GI18807-PA 438 GI18807-PA 191..425 37..257 319 31.1 Plus
Dmoj\GI20774-PA 454 GI20774-PA 206..444 37..261 287 31 Plus
Dmoj\GI23068-PA 387 GI23068-PA 154..387 37..262 245 32.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:11:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26716-PA 298 GL26716-PA 62..295 39..265 387 36 Plus
Dper\GL26286-PA 294 GL26286-PA 60..290 37..260 378 36 Plus
Dper\GL15455-PA 294 GL15455-PA 62..290 39..260 377 36.3 Plus
Dper\GL15454-PA 525 GL15454-PA 116..347 39..260 369 38.1 Plus
Dper\GL18967-PA 402 GL18967-PA 154..392 37..262 356 39 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:11:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA29220-PA 290 GA29220-PA 62..290 39..260 376 36.3 Plus
Dpse\GA29037-PA 335 GA29037-PA 103..331 39..260 371 35.9 Plus
Dpse\GA29036-PA 484 GA29036-PA 116..347 39..260 370 38.1 Plus
Dpse\GA26264-PA 429 GA26264-PA 184..417 39..260 317 35 Plus
Dpse\GA21292-PA 462 GA21292-PA 209..456 32..266 300 29 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:11:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16570-PA 277 GM16570-PA 1..277 1..270 1145 80.5 Plus
Dsec\GM11791-PA 405 GM11791-PA 157..401 37..269 344 35.4 Plus
Dsec\GM18188-PA 346 GM18188-PA 102..332 39..261 332 35.3 Plus
Dsec\GM16118-PA 457 GM16118-PA 113..338 40..256 315 34.2 Plus
Dsec\GM18641-PA 510 GM18641-PA 108..343 37..264 306 34.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:11:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22875-PA 190 GD22875-PA 1..175 1..171 762 84.6 Plus
Dsim\GD21938-PA 362 GD21938-PA 95..347 26..270 392 37.7 Plus
Dsim\GD13811-PA 323 GD13811-PA 72..309 39..268 363 35.1 Plus
Dsim\GD10182-PA 326 GD10182-PA 77..309 37..261 349 35.4 Plus
Dsim\GD22278-PA 405 GD22278-PA 157..395 37..262 341 35.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:11:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18039-PA 571 GJ18039-PA 329..559 39..260 388 39.5 Plus
Dvir\GJ21928-PA 395 GJ21928-PA 147..383 37..260 359 36.7 Plus
Dvir\GJ18191-PA 478 GJ18191-PA 213..448 39..261 345 36 Plus
Dvir\GJ18190-PA 289 GJ18190-PA 43..283 37..261 338 32.8 Plus
Dvir\GJ21834-PA 442 GJ21834-PA 199..436 37..260 304 31.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:11:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24265-PA 294 GK24265-PA 49..282 39..260 335 36.9 Plus
Dwil\GK21569-PA 454 GK21569-PA 207..445 37..261 311 31.4 Plus
Dwil\GK21734-PA 470 GK21734-PA 214..457 37..257 267 29.6 Plus
Dwil\GK19365-PA 210 GK19365-PA 5..198 81..260 257 34.5 Plus
Dwil\GK12466-PA 426 GK12466-PA 150..303 37..188 241 35.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:11:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15231-PA 278 GE15231-PA 1..268 1..261 949 66.9 Plus
Dyak\GE21411-PA 305 GE21411-PA 65..302 39..268 375 36.4 Plus
Dyak\GE19385-PA 366 GE19385-PA 108..344 36..264 375 39.3 Plus
Dyak\GE26141-PA 423 GE26141-PA 175..419 37..269 340 35 Plus
Dyak\GE21210-PA 550 GE21210-PA 109..351 37..270 339 36.3 Plus