Clone SD22440 Report

Search the DGRC for SD22440

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:224
Well:40
Vector:pOT2
Associated Gene/TranscriptRpS19b-RB
Protein status:SD22440.pep: gold
Preliminary Size:474
Sequenced Size:668

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5338 2002-01-01 Sim4 clustering to Release 2
CG5338 2002-05-18 Blastp of sequenced clone
CG5338 2003-01-01 Sim4 clustering to Release 3
RpS19b 2008-04-29 Release 5.5 accounting
RpS19b 2008-08-15 Release 5.9 accounting
RpS19b 2008-12-18 5.12 accounting

Clone Sequence Records

SD22440.complete Sequence

668 bp (668 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119257

> SD22440.complete
ATTTTGACTAAAGTCAGCAAACTAACCGGAAGCAAACCTTTTTCTTCTCA
AAAGAACGTAGAGAGCAACATGCCTGGAGTCACAGTAAAGGAAATCGATC
AGCACGTTCTGACCAAAAACATGGCTGCTTTTCTCAAAAAATCCGGAAAA
ATTTTTGTGCCCGAACAGGCCGTCTATATGAAGACTGGCAAGTTCAAGGA
GACTGCTCCTACCGACGACGACTGGTTCTACACTCGCTGCGCCTCTATTA
TGAGACACCTGTACCTGCGCAGTCCCGCCGGCGTTGGGGCCTTCACCAAG
GTCTATAGCGGGCGCAAGCGCAACGGTGTTCGTCCGTCCAAGCACTGTCG
CTCATCGGATGGCTGTATTCGCAAGGCTCTTCAAGCCTTGGAAGCTGCAA
ACATGGTGGAGAGGCACCCGGATGGTGGTCGTAAGCTGACTCCGCAAGGA
CAACGTAACTTGGATCGCATAGCCAACAAGATTGTGGCCAAGCAGCGAGA
GCGCAGTGCACCAGTTTCCATGATTATCACTACCTAAGATGATAATACCA
ATACCACGATGGATCATCTTTGAGTGCCTTGGGTTTTCAAAACATTCTCA
ATAAATCGAAACAATTATATACATAATAAAATAACTTAATACTTGAAATA
AAAAAAAAAAAAAAAAAA

SD22440.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:45:21
Subject Length Description Subject Range Query Range Score Percent Strand
RpS19b-RB 724 RpS19b-RB 59..670 1..612 3045 99.8 Plus
RpS19b-RB 724 RpS19b-RB 684..724 609..649 205 100 Plus
RpS19a.a 664 RpS19a.a 219..329 219..329 195 78.3 Plus
RpS19a-RB 666 RpS19a-RB 221..331 219..329 195 78.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:19:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 19756518..19756842 376..52 1625 100 Minus
chr3R 27901430 chr3R 19756175..19756450 649..374 1365 99.6 Minus
chr3R 27901430 chr3R 19756906..19756959 54..1 270 100 Minus
chrX 22417052 chrX 16528152..16528262 219..329 195 78.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:57:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:19:24
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23933089..23933413 376..52 1625 100 Minus
3R 32079331 3R 23932783..23933021 612..374 1180 99.6 Minus
3R 32079331 3R 23933477..23933530 54..1 270 100 Minus
X 23542271 X 16638484..16638594 219..329 195 78.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:05:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 23673920..23674244 376..52 1625 100 Minus
3R 31820162 3R 23673614..23673852 612..374 1180 99.5 Minus
3R 31820162 3R 23674308..23674361 54..1 270 100 Minus
3R 31820162 3R 23673555..23673600 654..609 215 97.8 Minus
X 23527363 X 16646582..16646692 219..329 195 78.3 Plus
Blast to na_te.dros performed on 2019-03-16 20:19:25 has no hits.

SD22440.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:20:22 Download gff for SD22440.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 19756175..19756448 376..649 91 <- Minus
chr3R 19756519..19756839 55..375 100 <- Minus
chr3R 19756906..19756959 1..54 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:10:09 Download gff for SD22440.complete
Subject Subject Range Query Range Percent Splice Strand
RpS19b-RB 1..468 70..537 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:39:32 Download gff for SD22440.complete
Subject Subject Range Query Range Percent Splice Strand
RpS19b-RB 1..468 70..537 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:00:34 Download gff for SD22440.complete
Subject Subject Range Query Range Percent Splice Strand
RpS19b-RB 1..468 70..537 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:16:32 Download gff for SD22440.complete
Subject Subject Range Query Range Percent Splice Strand
RpS19b-RB 1..468 70..537 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:58:37 Download gff for SD22440.complete
Subject Subject Range Query Range Percent Splice Strand
RpS19b-RB 1..468 70..537 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:44:21 Download gff for SD22440.complete
Subject Subject Range Query Range Percent Splice Strand
RpS19b-RB 630..666 613..649 100   Plus
RpS19b-RB 1..612 1..612 99 <- Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:39:31 Download gff for SD22440.complete
Subject Subject Range Query Range Percent Splice Strand
RpS19b-RB 1..612 1..612 99 <- Plus
RpS19b-RB 630..666 613..649 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:00:34 Download gff for SD22440.complete
Subject Subject Range Query Range Percent Splice Strand
RpS19b-RB 1..612 1..612 99 <- Plus
RpS19b-RB 630..666 613..649 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:16:32 Download gff for SD22440.complete
Subject Subject Range Query Range Percent Splice Strand
RpS19b-RB 1..612 1..612 99 <- Plus
RpS19b-RB 630..666 613..649 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:58:37 Download gff for SD22440.complete
Subject Subject Range Query Range Percent Splice Strand
RpS19b-RB 1..612 1..612 99 <- Plus
RpS19b-RB 630..666 613..649 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:20:22 Download gff for SD22440.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23932729..23932767 611..649 100 <- Minus
3R 23932785..23933019 376..610 99 <- Minus
3R 23933090..23933410 55..375 100 <- Minus
3R 23933477..23933530 1..54 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:20:22 Download gff for SD22440.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23932729..23932767 611..649 100 <- Minus
3R 23932785..23933019 376..610 99 <- Minus
3R 23933090..23933410 55..375 100 <- Minus
3R 23933477..23933530 1..54 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:20:22 Download gff for SD22440.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23932729..23932767 611..649 100 <- Minus
3R 23932785..23933019 376..610 99 <- Minus
3R 23933090..23933410 55..375 100 <- Minus
3R 23933477..23933530 1..54 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:00:34 Download gff for SD22440.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19758812..19759132 55..375 100 <- Minus
arm_3R 19759199..19759252 1..54 100   Minus
arm_3R 19758451..19758489 611..649 100 <- Minus
arm_3R 19758507..19758741 376..610 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:52:24 Download gff for SD22440.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23674308..23674361 1..54 100   Minus
3R 23673616..23673850 376..610 99 <- Minus
3R 23673921..23674241 55..375 100 <- Minus
3R 23673560..23673598 611..649 100 <- Minus

SD22440.hyp Sequence

Translation from 0 to 536

> SD22440.hyp
ILTKVSKLTGSKPFSSQKNVESNMPGVTVKEIDQHVLTKNMAAFLKKSGK
IFVPEQAVYMKTGKFKETAPTDDDWFYTRCASIMRHLYLRSPAGVGAFTK
VYSGRKRNGVRPSKHCRSSDGCIRKALQALEAANMVERHPDGGRKLTPQG
QRNLDRIANKIVAKQRERSAPVSMIITT*

SD22440.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:02:18
Subject Length Description Subject Range Query Range Score Percent Strand
RpS19b-PC 155 CG5338-PC 1..155 24..178 807 100 Plus
RpS19b-PB 155 CG5338-PB 1..155 24..178 807 100 Plus
RpS19a-PE 156 CG4464-PE 1..153 24..176 541 66.7 Plus
RpS19a-PA 156 CG4464-PA 1..153 24..176 541 66.7 Plus
RpS19a-PC 156 CG4464-PC 1..153 24..176 541 66.7 Plus

SD22440.pep Sequence

Translation from 69 to 536

> SD22440.pep
MPGVTVKEIDQHVLTKNMAAFLKKSGKIFVPEQAVYMKTGKFKETAPTDD
DWFYTRCASIMRHLYLRSPAGVGAFTKVYSGRKRNGVRPSKHCRSSDGCI
RKALQALEAANMVERHPDGGRKLTPQGQRNLDRIANKIVAKQRERSAPVS
MIITT*

SD22440.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:06:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17022-PA 156 GF17022-PA 1..155 1..155 669 76.8 Plus
Dana\GF21022-PA 156 GF21022-PA 1..155 1..155 562 65.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:06:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12389-PA 155 GG12389-PA 1..155 1..155 689 82.6 Plus
Dere\GG19061-PA 156 GG19061-PA 1..144 1..144 553 70.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:06:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12611-PA 156 GH12611-PA 1..155 1..155 562 66.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:39
Subject Length Description Subject Range Query Range Score Percent Strand
RpS19b-PC 155 CG5338-PC 1..155 1..155 807 100 Plus
RpS19b-PB 155 CG5338-PB 1..155 1..155 807 100 Plus
RpS19a-PE 156 CG4464-PE 1..153 1..153 541 66.7 Plus
RpS19a-PA 156 CG4464-PA 1..153 1..153 541 66.7 Plus
RpS19a-PC 156 CG4464-PC 1..153 1..153 541 66.7 Plus
RpS19a-PB 156 CG4464-PB 1..153 1..153 541 66.7 Plus
RpS19a-PD 156 CG4464-PD 1..153 1..153 541 66.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:06:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11025-PA 156 GI11025-PA 1..155 1..155 561 66.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:06:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24165-PA 163 GL24165-PA 1..153 1..152 630 75.8 Plus
Dper\GL27068-PA 156 GL27068-PA 1..144 1..144 551 69.4 Plus
Dper\GL18204-PA 156 GL18204-PA 1..144 1..144 551 69.4 Plus
Dper\GL13146-PA 151 GL13146-PA 1..139 1..144 458 61.8 Plus
Dper\GL15432-PA 104 GL15432-PA 31..81 92..142 142 54.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:06:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18813-PA 163 GA18813-PA 1..153 1..152 634 75.8 Plus
Dpse\GA27710-PA 156 GA27710-PA 1..144 1..144 551 69.4 Plus
Dpse\GA18203-PA 156 GA18203-PA 1..144 1..144 551 69.4 Plus
Dpse\GA23235-PA 156 GA23235-PA 1..144 1..144 531 66.7 Plus
Dpse\GA25986-PA 191 GA25986-PA 37..155 10..136 310 52.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:06:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23526-PA 155 GM23526-PA 1..155 1..155 778 92.3 Plus
Dsec\GM13451-PA 134 GM13451-PA 1..122 23..144 463 69.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:06:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18336-PA 155 GD18336-PA 1..155 1..155 778 92.3 Plus
Dsim\GD17290-PA 169 GD17290-PA 1..144 1..144 553 70.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:06:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15624-PA 156 GJ15624-PA 1..155 1..155 557 65.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:06:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22513-PA 156 GK22513-PA 1..155 1..155 566 65.8 Plus
Dwil\GK25712-PA 153 GK25712-PA 1..153 1..153 555 66.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:06:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10844-PA 155 GE10844-PA 1..155 1..155 705 82.6 Plus
Dyak\RpS19a-PA 156 GE17282-PA 1..144 1..144 553 70.1 Plus