BDGP Sequence Production Resources |
Search the DGRC for SD22440
Library: | SD |
Tissue Source: | Drosophila melanogaster Schneider L2 cell culture |
Created by: | Ling Hong |
Date Registered: | 1999-02-25 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 224 |
Well: | 40 |
Vector: | pOT2 |
Associated Gene/Transcript | RpS19b-RB |
Protein status: | SD22440.pep: gold |
Preliminary Size: | 474 |
Sequenced Size: | 668 |
Gene | Date | Evidence |
---|---|---|
CG5338 | 2002-01-01 | Sim4 clustering to Release 2 |
CG5338 | 2002-05-18 | Blastp of sequenced clone |
CG5338 | 2003-01-01 | Sim4 clustering to Release 3 |
RpS19b | 2008-04-29 | Release 5.5 accounting |
RpS19b | 2008-08-15 | Release 5.9 accounting |
RpS19b | 2008-12-18 | 5.12 accounting |
668 bp (668 high quality bases) assembled on 2002-05-18
GenBank Submission: AY119257
> SD22440.complete ATTTTGACTAAAGTCAGCAAACTAACCGGAAGCAAACCTTTTTCTTCTCA AAAGAACGTAGAGAGCAACATGCCTGGAGTCACAGTAAAGGAAATCGATC AGCACGTTCTGACCAAAAACATGGCTGCTTTTCTCAAAAAATCCGGAAAA ATTTTTGTGCCCGAACAGGCCGTCTATATGAAGACTGGCAAGTTCAAGGA GACTGCTCCTACCGACGACGACTGGTTCTACACTCGCTGCGCCTCTATTA TGAGACACCTGTACCTGCGCAGTCCCGCCGGCGTTGGGGCCTTCACCAAG GTCTATAGCGGGCGCAAGCGCAACGGTGTTCGTCCGTCCAAGCACTGTCG CTCATCGGATGGCTGTATTCGCAAGGCTCTTCAAGCCTTGGAAGCTGCAA ACATGGTGGAGAGGCACCCGGATGGTGGTCGTAAGCTGACTCCGCAAGGA CAACGTAACTTGGATCGCATAGCCAACAAGATTGTGGCCAAGCAGCGAGA GCGCAGTGCACCAGTTTCCATGATTATCACTACCTAAGATGATAATACCA ATACCACGATGGATCATCTTTGAGTGCCTTGGGTTTTCAAAACATTCTCA ATAAATCGAAACAATTATATACATAATAAAATAACTTAATACTTGAAATA AAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpS19b-RB | 724 | RpS19b-RB | 59..670 | 1..612 | 3045 | 99.8 | Plus |
RpS19b-RB | 724 | RpS19b-RB | 684..724 | 609..649 | 205 | 100 | Plus |
RpS19a.a | 664 | RpS19a.a | 219..329 | 219..329 | 195 | 78.3 | Plus |
RpS19a-RB | 666 | RpS19a-RB | 221..331 | 219..329 | 195 | 78.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 19756518..19756842 | 376..52 | 1625 | 100 | Minus |
chr3R | 27901430 | chr3R | 19756175..19756450 | 649..374 | 1365 | 99.6 | Minus |
chr3R | 27901430 | chr3R | 19756906..19756959 | 54..1 | 270 | 100 | Minus |
chrX | 22417052 | chrX | 16528152..16528262 | 219..329 | 195 | 78.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 23933089..23933413 | 376..52 | 1625 | 100 | Minus |
3R | 32079331 | 3R | 23932783..23933021 | 612..374 | 1180 | 99.6 | Minus |
3R | 32079331 | 3R | 23933477..23933530 | 54..1 | 270 | 100 | Minus |
X | 23542271 | X | 16638484..16638594 | 219..329 | 195 | 78.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 23673920..23674244 | 376..52 | 1625 | 100 | Minus |
3R | 31820162 | 3R | 23673614..23673852 | 612..374 | 1180 | 99.5 | Minus |
3R | 31820162 | 3R | 23674308..23674361 | 54..1 | 270 | 100 | Minus |
3R | 31820162 | 3R | 23673555..23673600 | 654..609 | 215 | 97.8 | Minus |
X | 23527363 | X | 16646582..16646692 | 219..329 | 195 | 78.3 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 19756175..19756448 | 376..649 | 91 | <- | Minus |
chr3R | 19756519..19756839 | 55..375 | 100 | <- | Minus |
chr3R | 19756906..19756959 | 1..54 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS19b-RB | 1..468 | 70..537 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS19b-RB | 1..468 | 70..537 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS19b-RB | 1..468 | 70..537 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS19b-RB | 1..468 | 70..537 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS19b-RB | 1..468 | 70..537 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS19b-RB | 630..666 | 613..649 | 100 | Plus | |
RpS19b-RB | 1..612 | 1..612 | 99 | <- | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS19b-RB | 1..612 | 1..612 | 99 | <- | Plus |
RpS19b-RB | 630..666 | 613..649 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS19b-RB | 1..612 | 1..612 | 99 | <- | Plus |
RpS19b-RB | 630..666 | 613..649 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS19b-RB | 1..612 | 1..612 | 99 | <- | Plus |
RpS19b-RB | 630..666 | 613..649 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS19b-RB | 1..612 | 1..612 | 99 | <- | Plus |
RpS19b-RB | 630..666 | 613..649 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 23932729..23932767 | 611..649 | 100 | <- | Minus |
3R | 23932785..23933019 | 376..610 | 99 | <- | Minus |
3R | 23933090..23933410 | 55..375 | 100 | <- | Minus |
3R | 23933477..23933530 | 1..54 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 23932729..23932767 | 611..649 | 100 | <- | Minus |
3R | 23932785..23933019 | 376..610 | 99 | <- | Minus |
3R | 23933090..23933410 | 55..375 | 100 | <- | Minus |
3R | 23933477..23933530 | 1..54 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 23932729..23932767 | 611..649 | 100 | <- | Minus |
3R | 23932785..23933019 | 376..610 | 99 | <- | Minus |
3R | 23933090..23933410 | 55..375 | 100 | <- | Minus |
3R | 23933477..23933530 | 1..54 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 19758812..19759132 | 55..375 | 100 | <- | Minus |
arm_3R | 19759199..19759252 | 1..54 | 100 | Minus | |
arm_3R | 19758451..19758489 | 611..649 | 100 | <- | Minus |
arm_3R | 19758507..19758741 | 376..610 | 99 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 23674308..23674361 | 1..54 | 100 | Minus | |
3R | 23673616..23673850 | 376..610 | 99 | <- | Minus |
3R | 23673921..23674241 | 55..375 | 100 | <- | Minus |
3R | 23673560..23673598 | 611..649 | 100 | <- | Minus |
Translation from 0 to 536
> SD22440.hyp ILTKVSKLTGSKPFSSQKNVESNMPGVTVKEIDQHVLTKNMAAFLKKSGK IFVPEQAVYMKTGKFKETAPTDDDWFYTRCASIMRHLYLRSPAGVGAFTK VYSGRKRNGVRPSKHCRSSDGCIRKALQALEAANMVERHPDGGRKLTPQG QRNLDRIANKIVAKQRERSAPVSMIITT*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpS19b-PC | 155 | CG5338-PC | 1..155 | 24..178 | 807 | 100 | Plus |
RpS19b-PB | 155 | CG5338-PB | 1..155 | 24..178 | 807 | 100 | Plus |
RpS19a-PE | 156 | CG4464-PE | 1..153 | 24..176 | 541 | 66.7 | Plus |
RpS19a-PA | 156 | CG4464-PA | 1..153 | 24..176 | 541 | 66.7 | Plus |
RpS19a-PC | 156 | CG4464-PC | 1..153 | 24..176 | 541 | 66.7 | Plus |
Translation from 69 to 536
> SD22440.pep MPGVTVKEIDQHVLTKNMAAFLKKSGKIFVPEQAVYMKTGKFKETAPTDD DWFYTRCASIMRHLYLRSPAGVGAFTKVYSGRKRNGVRPSKHCRSSDGCI RKALQALEAANMVERHPDGGRKLTPQGQRNLDRIANKIVAKQRERSAPVS MIITT*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF17022-PA | 156 | GF17022-PA | 1..155 | 1..155 | 669 | 76.8 | Plus |
Dana\GF21022-PA | 156 | GF21022-PA | 1..155 | 1..155 | 562 | 65.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG12389-PA | 155 | GG12389-PA | 1..155 | 1..155 | 689 | 82.6 | Plus |
Dere\GG19061-PA | 156 | GG19061-PA | 1..144 | 1..144 | 553 | 70.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH12611-PA | 156 | GH12611-PA | 1..155 | 1..155 | 562 | 66.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpS19b-PC | 155 | CG5338-PC | 1..155 | 1..155 | 807 | 100 | Plus |
RpS19b-PB | 155 | CG5338-PB | 1..155 | 1..155 | 807 | 100 | Plus |
RpS19a-PE | 156 | CG4464-PE | 1..153 | 1..153 | 541 | 66.7 | Plus |
RpS19a-PA | 156 | CG4464-PA | 1..153 | 1..153 | 541 | 66.7 | Plus |
RpS19a-PC | 156 | CG4464-PC | 1..153 | 1..153 | 541 | 66.7 | Plus |
RpS19a-PB | 156 | CG4464-PB | 1..153 | 1..153 | 541 | 66.7 | Plus |
RpS19a-PD | 156 | CG4464-PD | 1..153 | 1..153 | 541 | 66.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI11025-PA | 156 | GI11025-PA | 1..155 | 1..155 | 561 | 66.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24165-PA | 163 | GL24165-PA | 1..153 | 1..152 | 630 | 75.8 | Plus |
Dper\GL27068-PA | 156 | GL27068-PA | 1..144 | 1..144 | 551 | 69.4 | Plus |
Dper\GL18204-PA | 156 | GL18204-PA | 1..144 | 1..144 | 551 | 69.4 | Plus |
Dper\GL13146-PA | 151 | GL13146-PA | 1..139 | 1..144 | 458 | 61.8 | Plus |
Dper\GL15432-PA | 104 | GL15432-PA | 31..81 | 92..142 | 142 | 54.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA18813-PA | 163 | GA18813-PA | 1..153 | 1..152 | 634 | 75.8 | Plus |
Dpse\GA27710-PA | 156 | GA27710-PA | 1..144 | 1..144 | 551 | 69.4 | Plus |
Dpse\GA18203-PA | 156 | GA18203-PA | 1..144 | 1..144 | 551 | 69.4 | Plus |
Dpse\GA23235-PA | 156 | GA23235-PA | 1..144 | 1..144 | 531 | 66.7 | Plus |
Dpse\GA25986-PA | 191 | GA25986-PA | 37..155 | 10..136 | 310 | 52.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM23526-PA | 155 | GM23526-PA | 1..155 | 1..155 | 778 | 92.3 | Plus |
Dsec\GM13451-PA | 134 | GM13451-PA | 1..122 | 23..144 | 463 | 69.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD18336-PA | 155 | GD18336-PA | 1..155 | 1..155 | 778 | 92.3 | Plus |
Dsim\GD17290-PA | 169 | GD17290-PA | 1..144 | 1..144 | 553 | 70.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ15624-PA | 156 | GJ15624-PA | 1..155 | 1..155 | 557 | 65.8 | Plus |