Clone SD22926 Report

Search the DGRC for SD22926

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:229
Well:26
Vector:pOT2
Associated Gene/TranscriptNup37-RA
Protein status:SD22926.pep: gold
Preliminary Size:1027
Sequenced Size:1097

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11875 2004-03-05 Blastp of sequenced clone
CG11875 2008-04-29 Release 5.5 accounting
CG11875 2008-08-15 Release 5.9 accounting
CG11875 2008-12-18 5.12 accounting

Clone Sequence Records

SD22926.complete Sequence

1097 bp (1097 high quality bases) assembled on 2004-03-05

GenBank Submission: BT012297

> SD22926.complete
ATTTTTTTGGCGCCGGCTAATTGTTGCATATATCCCGCGAATAACAAACA
ATATTTATAGAAAGATGCGATCTGTCATCGAGCCCGACCACAGCATCCAG
CTTAATGAAGCCATCTACTGCTACGATATATGCACCAATGACTTTGCCTA
CAACCTAATCGCAGTGGCCTTCAGGAAACACTTGAGTCTGCTGCTCGTTG
GACTGCCGGAGGAGAGCGGCGAGTTCGGGTACACACGCCTGCAGGACATG
GACCTGGGCGAAAAGGAGCAGCGGAGCGTGAGCGCACTGGCCTTCTCGCC
GGACACCTCGCTCAACTGCACGCCCAACAATGTGACTTTGTGCGCGGCCA
ACGGCAGCCAGCTTAAACTATACCGCACCGATCTGGGCCAGTTCACCTCG
CTCCAGGTGCTCCGTGGGCATGGGGACTACGTCAACGATGTATCCTGGGT
TTGCGACGGCGAACTGCTGGCCTCCGTTAGCGATGACTTCACCTGCAGAT
TCTGGACGACGACAGGCGGCGGGGAGAATGTCATAACCTTTGGCCTGTCC
TCCGCTGGAATGTCCGTCAAGAGTCACCCCGAGGATCCCAACAAGGTTCT
TGTGGCGGAAAAGAAGGGCATCATTCATCTATACAATGTGACGCTCAAGC
AGACAGTCATCTCCGTGGAGTCGCCCAAATTCCCCCTGATGTCGGCGGAC
TGGGCCCACAGCAACCGGCTCTTCATCACCTCGCTGGCCGGCGGAGATGT
GGTTACCTGGGACCTGAACCGACCCTATGTGCCCGCGGATGTCAAGCAGG
TCCACGAGGATTGCGGCCGGGTGGTGCGCTTCGCGCCAGGCAGCTCCGAG
ATGGTTATCGCCATGGTCATCGGGCTGACTCTCAAAGTGTTCGCGGCCAA
GTCGACCGTTCCTCTGCTGGAGGCCTCCCTGAAATCCTATGGGGGAATGG
CCTGGCACCAGCGATTGCCGTACATTAGTGCGGTTTCCGATAGGAAACTG
CTCTTCTGGAAAGTGCAAATGAAGTAATTTATATAAAATTGTATGAATAA
TAAATAAAAGAATATAAAAAATATGATATAAAAAAAAAAAAAAAAAA

SD22926.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:51:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG11875-RA 1125 CG11875-RA 41..1125 1..1085 5425 100 Plus
CG11875.a 1145 CG11875.a 121..1145 61..1085 5125 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:00:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 21071722..21072184 617..1079 2315 100 Plus
chr3R 27901430 chr3R 21071256..21071666 208..618 2055 100 Plus
chr3R 27901430 chr3R 21070983..21071191 1..209 1045 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:57:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:00:00
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25248638..25249106 617..1085 2345 100 Plus
3R 32079331 3R 25248172..25248582 208..618 2055 100 Plus
3R 32079331 3R 25247899..25248107 1..209 1045 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:11:28
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 24989469..24989937 617..1085 2345 100 Plus
3R 31820162 3R 24989003..24989413 208..618 2055 100 Plus
3R 31820162 3R 24988730..24988938 1..209 1045 100 Plus
Blast to na_te.dros performed on 2019-03-16 21:00:01 has no hits.

SD22926.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:00:44 Download gff for SD22926.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 21070983..21071190 1..208 100 -> Plus
chr3R 21071257..21071665 209..617 100 -> Plus
chr3R 21071723..21072128 618..1023 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:10:17 Download gff for SD22926.complete
Subject Subject Range Query Range Percent Splice Strand
CG11875-RA 1..963 65..1027 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:48:10 Download gff for SD22926.complete
Subject Subject Range Query Range Percent Splice Strand
CG11875-RA 1..963 65..1027 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:44:15 Download gff for SD22926.complete
Subject Subject Range Query Range Percent Splice Strand
Nup37-RA 1..963 65..1027 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:29:20 Download gff for SD22926.complete
Subject Subject Range Query Range Percent Splice Strand
CG11875-RA 1..963 65..1027 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:02:40 Download gff for SD22926.complete
Subject Subject Range Query Range Percent Splice Strand
Nup37-RA 1..963 65..1027 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:57:55 Download gff for SD22926.complete
Subject Subject Range Query Range Percent Splice Strand
CG11875-RA 22..1100 1..1079 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:48:10 Download gff for SD22926.complete
Subject Subject Range Query Range Percent Splice Strand
CG11875-RA 22..1100 1..1079 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:44:15 Download gff for SD22926.complete
Subject Subject Range Query Range Percent Splice Strand
Nup37-RA 29..1107 1..1079 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:29:20 Download gff for SD22926.complete
Subject Subject Range Query Range Percent Splice Strand
CG11875-RA 22..1100 1..1079 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:02:40 Download gff for SD22926.complete
Subject Subject Range Query Range Percent Splice Strand
Nup37-RA 29..1107 1..1079 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:00:44 Download gff for SD22926.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25247899..25248106 1..208 100 -> Plus
3R 25248173..25248581 209..617 100 -> Plus
3R 25248639..25249100 618..1079 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:00:44 Download gff for SD22926.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25247899..25248106 1..208 100 -> Plus
3R 25248173..25248581 209..617 100 -> Plus
3R 25248639..25249100 618..1079 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:00:44 Download gff for SD22926.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25247899..25248106 1..208 100 -> Plus
3R 25248173..25248581 209..617 100 -> Plus
3R 25248639..25249100 618..1079 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:44:15 Download gff for SD22926.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21073621..21073828 1..208 100 -> Plus
arm_3R 21073895..21074303 209..617 100 -> Plus
arm_3R 21074361..21074822 618..1079 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:06:47 Download gff for SD22926.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24988730..24988937 1..208 100 -> Plus
3R 24989004..24989412 209..617 100 -> Plus
3R 24989470..24989931 618..1079 100   Plus

SD22926.hyp Sequence

Translation from 0 to 1026

> SD22926.hyp
FFWRRLIVAYIPRITNNIYRKMRSVIEPDHSIQLNEAIYCYDICTNDFAY
NLIAVAFRKHLSLLLVGLPEESGEFGYTRLQDMDLGEKEQRSVSALAFSP
DTSLNCTPNNVTLCAANGSQLKLYRTDLGQFTSLQVLRGHGDYVNDVSWV
CDGELLASVSDDFTCRFWTTTGGGENVITFGLSSAGMSVKSHPEDPNKVL
VAEKKGIIHLYNVTLKQTVISVESPKFPLMSADWAHSNRLFITSLAGGDV
VTWDLNRPYVPADVKQVHEDCGRVVRFAPGSSEMVIAMVIGLTLKVFAAK
STVPLLEASLKSYGGMAWHQRLPYISAVSDRKLLFWKVQMK*

SD22926.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:31:07
Subject Length Description Subject Range Query Range Score Percent Strand
Nup37-PB 320 CG11875-PB 1..320 22..341 1672 100 Plus
Nup37-PA 320 CG11875-PA 1..320 22..341 1672 100 Plus
CG10931-PA 345 CG10931-PA 60..254 102..300 174 28.6 Plus

SD22926.pep Sequence

Translation from 64 to 1026

> SD22926.pep
MRSVIEPDHSIQLNEAIYCYDICTNDFAYNLIAVAFRKHLSLLLVGLPEE
SGEFGYTRLQDMDLGEKEQRSVSALAFSPDTSLNCTPNNVTLCAANGSQL
KLYRTDLGQFTSLQVLRGHGDYVNDVSWVCDGELLASVSDDFTCRFWTTT
GGGENVITFGLSSAGMSVKSHPEDPNKVLVAEKKGIIHLYNVTLKQTVIS
VESPKFPLMSADWAHSNRLFITSLAGGDVVTWDLNRPYVPADVKQVHEDC
GRVVRFAPGSSEMVIAMVIGLTLKVFAAKSTVPLLEASLKSYGGMAWHQR
LPYISAVSDRKLLFWKVQMK*

SD22926.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:44:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17555-PA 322 GF17555-PA 1..322 1..320 1360 76.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:44:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11381-PA 320 GG11381-PA 1..320 1..320 1627 93.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:44:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17354-PA 334 GH17354-PA 1..334 1..320 1129 64.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:13:09
Subject Length Description Subject Range Query Range Score Percent Strand
Nup37-PB 320 CG11875-PB 1..320 1..320 1672 100 Plus
Nup37-PA 320 CG11875-PA 1..320 1..320 1672 100 Plus
CG10931-PA 345 CG10931-PA 60..254 81..279 174 28.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:44:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23891-PA 322 GI23891-PA 1..322 1..320 1223 68.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:44:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11990-PA 322 GL11990-PA 1..322 1..320 1268 71.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:44:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11251-PA 322 GA11251-PA 1..322 1..320 1268 71.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:44:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17824-PA 320 GM17824-PA 1..320 1..320 1676 97.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:45:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21192-PA 320 GD21192-PA 1..320 1..320 1676 97.5 Plus
Dsim\GD13274-PA 257 GD13274-PA 1..210 1..210 1081 95.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:45:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23983-PA 322 GJ23983-PA 1..322 1..320 1243 70 Plus
Dvir\GJ22241-PA 373 GJ22241-PA 74..323 66..320 150 25.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:45:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12951-PA 322 GK12951-PA 1..322 1..320 1251 70.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:45:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23578-PA 320 GE23578-PA 1..320 1..320 1629 93.8 Plus