Clone SD23432 Report

Search the DGRC for SD23432

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:234
Well:32
Vector:pOT2
Associated Gene/TranscriptRpII15-RA
Protein status:SD23432.pep: gold
Sequenced Size:707

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Lost to the ancients 2008-12-08 I'm sure there was a reason

Clone Sequence Records

SD23432.complete Sequence

707 bp assembled on 2008-12-08

GenBank Submission: BT053756.1

> SD23432.complete
CAACGATAAAAAGCCAATAGCCATGACGACTGCCTTTGATGCCGCACACA
CTGAGGGGCCGGGATTCGTGGGCATTCGGTTCTGCCAGGAGTGCAACAAC
ATGCTGTACCCCAAGGAGGACAAGGAGAACAAGATCCTGCTGTACGCCTG
CCGGAATTGCGATTACAAACAGGAGGCGGACTCCAACTGCATCTACGTGA
ACAAGATTATGCACGAGATCGACGAGCTGACCCACATTGTGCCCGACGTG
ATTTCCGATCCCACGCTGCCGCGCACCGAAGACCACGCTTGTCCCAAGTG
CTCCCATCGGGAGGCGGTCTTCTTCCAGGCGCAAACTCGTCGCGCCGAAG
AGGAGATGCGACTGTACTACGTGTGCACCAACCAGAACTGCACCCACCGT
TGGACGGAGTAGAAACTGACGACCCATCTGCCTCTAATTGTAGCCCTAAG
TAATCGAAGGCACTTTGCAATCGTACAATTGGAATTCCCCCATGGCTATG
CCGCAAAAACATCCCACGTGCAGCTCCATTCTCGGTTGTCGCCTAATGTA
ATAACATTCGCACTGAAAAAAAATGCATGTGATCCGCATGACTTTGAATC
ACTTGCAAGAACTTCGATTTGGTTTGTATAAATGTTTAAATAGCTCAGTC
TTAAAAATAAATATATAAGTTCATTGCGAGAAAAAAAAAAAAAAAAAAAA
AAAAAAA

SD23432.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:14:33
Subject Length Description Subject Range Query Range Score Percent Strand
RpII15-RA 1140 RpII15-RA 57..740 1..684 3420 100 Plus
RpII15.c 1140 RpII15.c 57..740 1..684 3420 100 Plus
RpII15.b 1135 RpII15.b 68..733 19..684 3330 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:04:30
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 10134001..10134670 11..680 3335 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:58:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:04:28
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 14309175..14309848 11..684 3370 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:32:14
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 14050006..14050679 11..684 3370 100 Plus
Blast to na_te.dros performed on 2019-03-16 10:04:29 has no hits.

SD23432.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:05:14 Download gff for SD23432.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 10133996..10134670 6..680 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:59:59 Download gff for SD23432.complete
Subject Subject Range Query Range Percent Splice Strand
RpII15-RA 1..390 23..412 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:21:19 Download gff for SD23432.complete
Subject Subject Range Query Range Percent Splice Strand
RpII15-RA 1..390 23..412 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:10:00 Download gff for SD23432.complete
Subject Subject Range Query Range Percent Splice Strand
RpII15-RA 1..390 23..412 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:54:16 Download gff for SD23432.complete
Subject Subject Range Query Range Percent Splice Strand
RpII15-RA 1..390 23..412 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-12-08 16:33:50 Download gff for SD23432.complete
Subject Subject Range Query Range Percent Splice Strand
RpII15-RA 17..696 1..680 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:21:19 Download gff for SD23432.complete
Subject Subject Range Query Range Percent Splice Strand
RpII15-RA 17..696 1..680 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:10:00 Download gff for SD23432.complete
Subject Subject Range Query Range Percent Splice Strand
RpII15-RA 36..715 1..680 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:54:16 Download gff for SD23432.complete
Subject Subject Range Query Range Percent Splice Strand
RpII15-RA 22..701 1..680 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:05:14 Download gff for SD23432.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14309170..14309844 6..680 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:05:14 Download gff for SD23432.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14309170..14309844 6..680 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:05:14 Download gff for SD23432.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14309170..14309844 6..680 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:10:00 Download gff for SD23432.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 10134892..10135566 6..680 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:52:56 Download gff for SD23432.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14050001..14050675 6..680 99   Plus

SD23432.pep Sequence

Translation from 1 to 411

> SD23432.pep
NDKKPIAMTTAFDAAHTEGPGFVGIRFCQECNNMLYPKEDKENKILLYAC
RNCDYKQEADSNCIYVNKIMHEIDELTHIVPDVISDPTLPRTEDHACPKC
SHREAVFFQAQTRRAEEEMRLYYVCTNQNCTHRWTE*

SD23432.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:29:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16163-PA 129 GF16163-PA 1..129 8..136 686 96.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:29:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16847-PA 129 GG16847-PA 1..129 8..136 701 100 Plus
Dere\GG20841-PA 108 GG20841-PA 4..106 27..134 140 32.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:29:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18685-PA 129 GH18685-PA 1..129 8..136 669 93.8 Plus
Dgri\GH19894-PA 108 GH19894-PA 4..106 27..134 145 30.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:18:18
Subject Length Description Subject Range Query Range Score Percent Strand
RpII15-PC 129 CG3284-PC 1..129 8..136 722 100 Plus
RpII15-PB 129 CG3284-PB 1..129 8..136 722 100 Plus
RpII15-PA 129 CG3284-PA 1..129 8..136 722 100 Plus
CG33785-PA 108 CG33785-PA 4..108 27..136 157 30.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:29:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10814-PA 103 GI10814-PA 1..103 34..136 543 97.1 Plus
Dmoj\GI19850-PA 108 GI19850-PA 4..106 27..134 152 32.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:29:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23270-PA 129 GL23270-PA 1..129 8..136 698 99.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:29:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17176-PA 129 GA17176-PA 1..129 8..136 698 99.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:29:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24158-PA 129 GM24158-PA 1..129 8..136 701 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:29:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18953-PA 129 GD18953-PA 1..129 8..136 701 100 Plus
Dsim\GD25260-PA 108 GD25260-PA 4..106 27..134 138 31.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:29:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14413-PA 129 GJ14413-PA 1..129 8..136 678 95.3 Plus
Dvir\GJ18820-PA 108 GJ18820-PA 4..106 27..134 150 32.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:29:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11344-PA 129 GK11344-PA 1..129 8..136 686 96.9 Plus
Dwil\GK21590-PA 108 GK21590-PA 2..106 25..134 149 32.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:29:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24228-PA 129 GE24228-PA 1..129 8..136 701 100 Plus
Dyak\GE13781-PA 108 GE13781-PA 4..106 27..134 140 32.4 Plus

SD23432.hyp Sequence

Translation from 7 to 411

> SD23432.hyp
CKPIAMTTAFDAAHTEGPGFVGIRFCQECNNMLYPKEDKENKILLYACRN
CDYKQEADSNCIYVNKIMHEIDELTHIVPDVISDPTLPRTEDHACPKCSH
REAVFFQAQTRRAEEEMRLYYVCTNQNCTHRWTE*

SD23432.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:22:52
Subject Length Description Subject Range Query Range Score Percent Strand
RpII15-PC 129 CG3284-PC 1..129 6..134 722 100 Plus
RpII15-PB 129 CG3284-PB 1..129 6..134 722 100 Plus
RpII15-PA 129 CG3284-PA 1..129 6..134 722 100 Plus
CG33785-PA 108 CG33785-PA 4..108 25..134 157 30.9 Plus