Clone SD23735 Report

Search the DGRC for SD23735

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:237
Well:35
Vector:pOT2
Associated Gene/TranscriptImpL2-RC
Protein status:SD23735.pep: gold
Preliminary Size:1630
Sequenced Size:1015

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15009 2004-03-05 Blastp of sequenced clone
ImpL2 2008-04-29 Release 5.5 accounting
ImpL2 2008-08-15 Release 5.9 accounting
ImpL2 2008-12-18 5.12 accounting

Clone Sequence Records

SD23735.complete Sequence

1015 bp (1015 high quality bases) assembled on 2004-03-05

GenBank Submission: BT012298

> SD23735.complete
CCGACTGAAGGCCTTGCGTTCTTATCGGGGAAATAGACTCGGAGACCTCC
CCTGATTAATGGAGGCGAAAATGAATTTACATGTGTGCGCCTTAGCGCTG
CTGCTGTTCGGCAGCATCGCCACTGTCCGCGGAAGAGCCGTGGACCTGGT
AGACGATAGCAACGACGTGGATAACTCCATCGAGGCGGAGGAGGAGAAGC
CACGCAACCGAGCCTTCGAAGCCGACTGGCTCAAGTTCACCAAGACGCCG
CCGACGAAGCTGCAGCAGGCCGATGGAGCCACCATCGAGATCGTTTGCGA
GATGATGGGCTCCCAAGTGCCCAGCATCCAGTGGGTGGTGGGTCACCTGC
CCCGCTCGGAGCTCGATGATCTGGACTCCAACCAGGTTGCCGAAGAGGCG
CCCAGTGCCATTGTGCGCGTCCGATCGTCGCATATCATCGACCACGTGCT
GAGCGAGGCCCGCACCTACACGTGTGTGGGACGCACTGGCTCCAAGACCA
TCTATGCCAGCACTGTGGTGCATCCTCCTCGCTCCTCTCGTCTGACGCCG
GAGAAGACCTACCCGGGTGCCCAGAAACCGCGAATCATCTACACCGAGAA
GACGCATCTGGACCTCATGGGCTCCAACATTCAGCTGCCCTGCCGCGTGC
ACGCCCGTCCCCGCGCCGAGATCACCTGGTTGAATAACGAGAACAAGGAG
ATCGTCCAAGGACATCGCCACAGGGTGCTGGCCAACGGCGATCTTCTGAT
CTCCGAGATCAAGTGGGAGGATATGGGCAACTACAAGTGCATAGCCCGCA
ACGTCGTCGGAAAGGATACCGCCGATACCTTCGTGTATCCCGTACTTAAT
GAGGAAGACTAAAGATCCTACCACCAAATAAAAAACAAAAGGCTATTGGA
TTGACGACGGAAATTCATCTAGTTAGTTAGATAGATCAAATGCCTTCGAA
GATGCGTGAAAAGAAATGAAATATGCTTAGAAAAAATACAAAAAAAAAAA
AAAAAAAAAAAAAAA

SD23735.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:03:29
Subject Length Description Subject Range Query Range Score Percent Strand
ImpL2-RC 1301 ImpL2-RC 3..1015 1..1013 5035 99.8 Plus
ImpL2.e 1633 ImpL2.e 3..1015 1..1013 5035 99.8 Plus
ImpL2.c 1833 ImpL2.c 259..1205 67..1013 4705 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:41:17
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 4224313..4225093 847..67 3905 100 Minus
chr3L 24539361 chr3L 4224096..4224237 989..848 710 100 Minus
chr3L 24539361 chr3L 4225270..4225336 67..1 335 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:58:14 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:41:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4224927..4225707 847..67 3905 100 Minus
3L 28110227 3L 4224686..4224851 1013..848 800 98.8 Minus
3L 28110227 3L 4225884..4225950 67..1 335 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:51:35
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 4224927..4225707 847..67 3905 100 Minus
3L 28103327 3L 4224686..4224851 1013..848 800 98.7 Minus
3L 28103327 3L 4225884..4225950 67..1 335 100 Minus
Blast to na_te.dros performed on 2019-03-15 14:41:16 has no hits.

SD23735.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:41:56 Download gff for SD23735.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 4224105..4224237 848..980 100 <- Minus
chr3L 4224313..4225092 68..847 100 <- Minus
chr3L 4225270..4225336 1..67 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:10:29 Download gff for SD23735.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL2-RC 1..804 59..862 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:39:07 Download gff for SD23735.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL2-RC 1..804 59..862 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:39:48 Download gff for SD23735.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL2-RC 1..804 59..862 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:22:52 Download gff for SD23735.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL2-RC 1..804 59..862 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:06:51 Download gff for SD23735.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL2-RC 1..804 59..862 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:47:20 Download gff for SD23735.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL2-RC 1..989 1..989 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:39:06 Download gff for SD23735.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL2-RC 1..989 1..989 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:39:48 Download gff for SD23735.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL2-RC 1..989 1..989 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:22:52 Download gff for SD23735.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL2-RC 1..989 1..989 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:06:51 Download gff for SD23735.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL2-RC 1..989 1..989 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:41:56 Download gff for SD23735.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4224710..4224851 848..989 100 <- Minus
3L 4224927..4225706 68..847 100 <- Minus
3L 4225884..4225950 1..67 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:41:56 Download gff for SD23735.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4224710..4224851 848..989 100 <- Minus
3L 4224927..4225706 68..847 100 <- Minus
3L 4225884..4225950 1..67 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:41:56 Download gff for SD23735.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4224710..4224851 848..989 100 <- Minus
3L 4224927..4225706 68..847 100 <- Minus
3L 4225884..4225950 1..67 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:39:48 Download gff for SD23735.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4224710..4224851 848..989 100 <- Minus
arm_3L 4224927..4225706 68..847 100 <- Minus
arm_3L 4225884..4225950 1..67 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:00:17 Download gff for SD23735.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4225884..4225950 1..67 100   Minus
3L 4224927..4225706 68..847 100 <- Minus
3L 4224710..4224851 848..989 100 <- Minus

SD23735.pep Sequence

Translation from 58 to 861

> SD23735.pep
MEAKMNLHVCALALLLFGSIATVRGRAVDLVDDSNDVDNSIEAEEEKPRN
RAFEADWLKFTKTPPTKLQQADGATIEIVCEMMGSQVPSIQWVVGHLPRS
ELDDLDSNQVAEEAPSAIVRVRSSHIIDHVLSEARTYTCVGRTGSKTIYA
STVVHPPRSSRLTPEKTYPGAQKPRIIYTEKTHLDLMGSNIQLPCRVHAR
PRAEITWLNNENKEIVQGHRHRVLANGDLLISEIKWEDMGNYKCIARNVV
GKDTADTFVYPVLNEED*

SD23735.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:35:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23872-PA 267 GF23872-PA 1..267 5..267 1175 82.4 Plus
Dana\GF21814-PA 1407 GF21814-PA 341..512 60..256 167 27.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:35:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14204-PA 263 GG14204-PA 1..263 5..267 1401 98.9 Plus
Dere\GG18259-PA 1239 GG18259-PA 341..512 60..256 152 25.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:35:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15542-PA 276 GH15542-PA 1..276 5..267 1042 71 Plus
Dgri\GH24930-PA 1298 GH24930-PA 340..510 60..255 177 27.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:25:24
Subject Length Description Subject Range Query Range Score Percent Strand
ImpL2-PC 267 CG15009-PC 1..267 1..267 1394 100 Plus
ImpL2-PA 266 CG15009-PA 3..266 4..267 1380 100 Plus
ImpL2-PD 263 CG15009-PD 1..263 5..267 1375 100 Plus
ImpL2-PB 263 CG15009-PB 1..263 5..267 1375 100 Plus
Nrg-PH 1239 CG1634-PH 341..512 60..256 152 26.7 Plus
Nrg-PF 1239 CG1634-PF 341..512 60..256 152 26.7 Plus
Nrg-PD 1239 CG1634-PD 341..512 60..256 152 26.7 Plus
Nrg-PC 1239 CG1634-PC 341..512 60..256 152 26.7 Plus
Nrg-PA 1239 CG1634-PA 341..512 60..256 152 26.7 Plus
Nrg-PI 1302 CG1634-PI 341..512 60..256 152 26.7 Plus
Nrg-PE 1302 CG1634-PE 341..512 60..256 152 26.7 Plus
Nrg-PB 1302 CG1634-PB 341..512 60..256 152 26.7 Plus
Nrg-PG 1309 CG1634-PG 341..512 60..256 152 26.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:35:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16817-PA 272 GI16817-PA 1..272 5..266 1068 71.7 Plus
Dmoj\GI16006-PA 1302 GI16006-PA 349..519 60..255 170 28.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:35:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12728-PA 81 GL12728-PA 1..65 82..146 272 78.5 Plus
Dper\GL22653-PA 1309 GL22653-PA 340..511 60..256 149 26.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:35:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16789-PA 332 GA16789-PA 1..265 5..264 1083 78.5 Plus
Dpse\GA14061-PA 1309 GA14061-PA 340..511 60..256 151 26.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:35:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13995-PA 267 GM13995-PA 1..267 1..267 1415 98.5 Plus
Dsec\GM21680-PA 1305 GM21680-PA 341..512 60..256 149 25.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:35:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\ImpL2-PA 266 GD13276-PA 3..266 4..267 1411 99.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:35:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12564-PA 332 GJ12564-PA 59..329 4..263 1021 70.8 Plus
Dvir\GJ18818-PA 1292 GJ18818-PA 340..511 60..256 170 28.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:35:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10204-PA 309 GK10204-PA 40..309 4..267 1030 70.5 Plus
Dwil\GK25863-PA 1304 GK25863-PA 340..511 60..256 154 26.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:35:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20632-PA 279 GE20632-PA 16..279 4..267 1397 98.1 Plus
Dyak\GE15791-PA 1239 GE15791-PA 341..512 60..256 151 25.9 Plus

SD23735.hyp Sequence

Translation from 58 to 861

> SD23735.hyp
MEAKMNLHVCALALLLFGSIATVRGRAVDLVDDSNDVDNSIEAEEEKPRN
RAFEADWLKFTKTPPTKLQQADGATIEIVCEMMGSQVPSIQWVVGHLPRS
ELDDLDSNQVAEEAPSAIVRVRSSHIIDHVLSEARTYTCVGRTGSKTIYA
STVVHPPRSSRLTPEKTYPGAQKPRIIYTEKTHLDLMGSNIQLPCRVHAR
PRAEITWLNNENKEIVQGHRHRVLANGDLLISEIKWEDMGNYKCIARNVV
GKDTADTFVYPVLNEED*

SD23735.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:38:26
Subject Length Description Subject Range Query Range Score Percent Strand
ImpL2-PC 267 CG15009-PC 1..267 1..267 1394 100 Plus
ImpL2-PA 266 CG15009-PA 3..266 4..267 1380 100 Plus
ImpL2-PD 263 CG15009-PD 1..263 5..267 1375 100 Plus
ImpL2-PB 263 CG15009-PB 1..263 5..267 1375 100 Plus
Nrg-PH 1239 CG1634-PH 341..512 60..256 152 26.7 Plus