Clone SD23839 Report

Search the DGRC for SD23839

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:238
Well:39
Vector:pOT2
Associated Gene/TranscriptRoc1a-RA
Protein status:SD23839.pep: gold
Preliminary Size:692
Sequenced Size:1181

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG16982 2002-01-01 Sim4 clustering to Release 2
CG16982 2002-05-18 Blastp of sequenced clone
CG16982 2003-01-01 Sim4 clustering to Release 3
Roc1a 2008-04-29 Release 5.5 accounting
Roc1a 2008-08-15 Release 5.9 accounting
Roc1a 2008-12-18 5.12 accounting

Clone Sequence Records

SD23839.complete Sequence

1181 bp (1181 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119265

> SD23839.complete
CTTTACGAGAAAAAGCGGCGGTCACACTGCTTGAGCCTCACTGCGAGTGG
TTTTCTATTAAAACGAAAAGGATAGGGACAGAAAAGCCAAAACTACGTTA
GTTGTGAAAATTGCATTTGTGTTGCGAGAGTTTTGTCAGGATAAATAGGT
GTATTTCCACCATGGAAGTCGACGAGGATGGATACGAGGTTCCCTCCAGC
AGCAGCAAGGGCGATAAGAAGCGCTTTGAGGTGAAGAAGTGGAACGCCGT
GGCTCTGTGGGCCTGGGACATCGTGGTGGACAACTGCGCCATCTGCCGCA
ACCACATCATGGACTTGTGCATCGAGTGTCAGGCGAACCAGGCGTCCGCC
ACTAGCGAGGAGTGCACCGTGGCCTGGGGCGTCTGCAACCACGCCTTCCA
TTTCCACTGCATCTCTCGCTGGCTAAAGACGCGCCAGGTATGCCCACTGG
ACAACCGCGAGTGGGATTTCCAGAAGTACGGCCACTAAAATCTACAAAAC
CCCCAAGACCCACCAGATGGAGGGAGCAGCACTTCCCGCAAGCTAGATGA
TGGAGGCCTGCTTCATCTGGACATTTGAATACCTTTTTAGATCTTAAGCT
AGTGGGGCGATTCGAGTGAACTGGTAGCCTTTAGGAGCACAGTTACCGAT
TTCCGAGACTCCCCGGGAAGCGCACCTTTTTGTAACGCGTTAAATAAAAG
CTGTAGAAGATGGAGAAGACTAGACGGATGTTTCTACCTTTCACCCTTTG
GAGTCTATATTCACTGTGACGATGGCATCTTACCGCGAAATCCACTAGCT
AGTCGTGCCTAAATTTTCAGAGTATATAACTCATGACTGGCAAAAAATAT
GATTGGGTCATTGGGTTCCATAAATGTAGCTCTGCTTAGTTATCCTTGGA
TGGCATTTGAAGAGGATCTGGCTAGTTCAAACTAGTTTAGTTTTGCTTAA
CTATATGCGTCATGACCAGCTCCAGATCAGGTTGTTCAGATATATGAAAG
TAGTTTCGTAAAAACAAATCAAAATCAGTCGATGCAAAGAAAGAGCTGCG
TTTGTAAAAACTAAATGTTCTTTTTAGTTTATTATGAATGTTTTGCGGCC
GCGGCAGCTTAGAAAATAATACACATTAGTTACAGATATGAATAAAGTAT
ATGGTATATATCAAAAAAAAAAAAAAAAAAA

SD23839.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:59:59
Subject Length Description Subject Range Query Range Score Percent Strand
Roc1a-RA 1243 Roc1a-RA 68..1232 1..1165 5825 100 Plus
Roc1a.a 1327 Roc1a.a 389..1316 238..1165 4640 100 Plus
Roc1a.a 1327 Roc1a.a 68..306 1..239 1195 100 Plus
Suv4-20.a 5546 Suv4-20.a 5435..5546 1165..1054 560 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-17 00:00:00
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 541688..542583 267..1162 4480 100 Plus
chrX 22417052 chrX 541273..541511 1..239 1195 100 Plus
chr3L 24539361 chr3L 358087..358351 220..487 435 78.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:58:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:59:58
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 647702..648600 267..1165 4495 100 Plus
X 23542271 X 647287..647525 1..239 1195 100 Plus
3L 28110227 3L 358134..358398 220..487 435 78.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:31:57
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 655800..656698 267..1165 4495 100 Plus
X 23527363 X 655385..655623 1..239 1195 100 Plus
3L 28103327 3L 358271..358398 360..487 310 82.8 Plus
3L 28103327 3L 358170..358253 256..339 240 85.7 Plus
X 23527363 X 655706..655735 238..267 150 100 Plus
Blast to na_te.dros performed 2019-03-16 23:59:58
Subject Length Description Subject Range Query Range Score Percent Strand
rover 7318 rover ROVER 7318bp 4486..4545 981..1042 115 69.4 Plus

SD23839.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 00:01:02 Download gff for SD23839.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 541273..541511 1..239 100 -> Plus
chrX 541596..541623 240..267 100 -> Plus
chrX 541689..542583 268..1162 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:10:32 Download gff for SD23839.complete
Subject Subject Range Query Range Percent Splice Strand
Roc1a-RA 1..327 162..488 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:39:59 Download gff for SD23839.complete
Subject Subject Range Query Range Percent Splice Strand
Roc1a-RA 1..327 162..488 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:27:50 Download gff for SD23839.complete
Subject Subject Range Query Range Percent Splice Strand
Roc1a-RA 1..327 162..488 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:31:42 Download gff for SD23839.complete
Subject Subject Range Query Range Percent Splice Strand
Roc1a-RA 1..327 162..488 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:07:12 Download gff for SD23839.complete
Subject Subject Range Query Range Percent Splice Strand
Roc1a-RA 1..327 162..488 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:13:20 Download gff for SD23839.complete
Subject Subject Range Query Range Percent Splice Strand
Roc1a-RA 1..1162 1..1162 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:39:59 Download gff for SD23839.complete
Subject Subject Range Query Range Percent Splice Strand
Roc1a-RA 1..1162 1..1162 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:27:50 Download gff for SD23839.complete
Subject Subject Range Query Range Percent Splice Strand
Roc1a-RD 1..1145 18..1162 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:31:43 Download gff for SD23839.complete
Subject Subject Range Query Range Percent Splice Strand
Roc1a-RA 1..1162 1..1162 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:07:12 Download gff for SD23839.complete
Subject Subject Range Query Range Percent Splice Strand
Roc1a-RD 1..1145 18..1162 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:01:02 Download gff for SD23839.complete
Subject Subject Range Query Range Percent Splice Strand
X 647287..647525 1..239 100 -> Plus
X 647610..647637 240..267 100 -> Plus
X 647703..648597 268..1162 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:01:02 Download gff for SD23839.complete
Subject Subject Range Query Range Percent Splice Strand
X 647287..647525 1..239 100 -> Plus
X 647610..647637 240..267 100 -> Plus
X 647703..648597 268..1162 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:01:02 Download gff for SD23839.complete
Subject Subject Range Query Range Percent Splice Strand
X 647287..647525 1..239 100 -> Plus
X 647610..647637 240..267 100 -> Plus
X 647703..648597 268..1162 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:27:50 Download gff for SD23839.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 541320..541558 1..239 100 -> Plus
arm_X 541643..541670 240..267 100 -> Plus
arm_X 541736..542630 268..1162 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:04:18 Download gff for SD23839.complete
Subject Subject Range Query Range Percent Splice Strand
X 655385..655623 1..239 100 -> Plus
X 655708..655735 240..267 100 -> Plus
X 655801..656695 268..1162 100   Plus

SD23839.hyp Sequence

Translation from 161 to 487

> SD23839.hyp
MEVDEDGYEVPSSSSKGDKKRFEVKKWNAVALWAWDIVVDNCAICRNHIM
DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNRE
WDFQKYGH*

SD23839.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:27:00
Subject Length Description Subject Range Query Range Score Percent Strand
Roc1a-PD 108 CG16982-PD 1..108 1..108 619 100 Plus
Roc1a-PA 108 CG16982-PA 1..108 1..108 619 100 Plus
Roc1a-PC 136 CG16982-PC 1..136 1..108 580 79.4 Plus
Roc1b-PA 122 CG16988-PA 21..121 9..107 395 67.6 Plus
Roc2-PB 113 CG8998-PB 6..112 5..107 274 43.9 Plus

SD23839.pep Sequence

Translation from 161 to 487

> SD23839.pep
MEVDEDGYEVPSSSSKGDKKRFEVKKWNAVALWAWDIVVDNCAICRNHIM
DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNRE
WDFQKYGH*

SD23839.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:10:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13953-PA 108 GF13953-PA 1..108 1..108 558 96.3 Plus
Dana\GF22186-PA 108 GF22186-PA 1..108 1..108 558 96.3 Plus
Dana\GF21496-PA 146 GF21496-PA 40..146 2..108 468 79.4 Plus
Dana\GF20771-PA 154 GF20771-PA 47..154 1..108 445 75.9 Plus
Dana\GF20493-PA 194 GF20493-PA 88..194 2..108 433 73.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:10:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12803-PA 108 GG12803-PA 1..108 1..108 558 96.3 Plus
Dere\GG14721-PA 122 GG14721-PA 16..122 1..108 371 62 Plus
Dere\GG22636-PA 113 GG22636-PA 3..112 4..107 245 43.6 Plus
Dere\GG24061-PA 85 GG24061-PA 2..85 21..106 160 34.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 04:10:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17811-PA 108 GH17811-PA 1..108 1..108 558 96.3 Plus
Dgri\GH10088-PA 159 GH10088-PA 70..159 19..108 390 76.7 Plus
Dgri\GH15458-PA 128 GH15458-PA 24..128 2..108 380 67.3 Plus
Dgri\GH22607-PA 128 GH22607-PA 24..128 2..108 380 67.3 Plus
Dgri\GH23818-PA 128 GH23818-PA 24..128 2..108 380 67.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:18:43
Subject Length Description Subject Range Query Range Score Percent Strand
Roc1a-PD 108 CG16982-PD 1..108 1..108 619 100 Plus
Roc1a-PA 108 CG16982-PA 1..108 1..108 619 100 Plus
Roc1a-PC 136 CG16982-PC 1..136 1..108 580 79.4 Plus
Roc1b-PA 122 CG16988-PA 21..121 9..107 395 67.6 Plus
Roc2-PB 113 CG8998-PB 6..112 5..107 274 43.9 Plus
Roc2-PA 113 CG8998-PA 6..112 5..107 274 43.9 Plus
lmgA-PB 85 CG34440-PB 5..82 24..103 189 37.3 Plus
lmgA-PA 85 CG18042-PA 5..82 24..103 189 37.3 Plus
lmgA-PD 85 CG34440-PD 5..82 24..103 189 37.3 Plus
lmgA-PC 85 CG34440-PC 5..82 24..103 189 37.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 04:10:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16422-PA 108 GI16422-PA 1..108 1..108 562 97.2 Plus
Dmoj\GI20142-PA 147 GI20142-PA 57..146 18..107 410 80 Plus
Dmoj\GI14277-PA 159 GI14277-PA 70..158 19..107 403 80.9 Plus
Dmoj\GI16738-PA 130 GI16738-PA 27..130 2..108 373 67.3 Plus
Dmoj\GI21036-PA 111 GI21036-PA 13..110 11..107 245 47.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:10:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13357-PA 108 GL13357-PA 1..108 1..108 558 96.3 Plus
Dper\GL14784-PA 284 GL14784-PA 179..283 3..107 427 75.2 Plus
Dper\GL22584-PA 123 GL22584-PA 16..123 2..108 372 65.1 Plus
Dper\GL10569-PA 102 GL10569-PA 1..101 1..107 310 54.2 Plus
Dper\GL10672-PA 113 GL10672-PA 6..112 5..107 244 43.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:10:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22841-PA 108 GA22841-PA 1..108 1..108 558 96.3 Plus
Dpse\GA23017-PA 150 GA23017-PA 45..150 3..108 405 72.6 Plus
Dpse\GA14260-PA 123 GA14260-PA 16..123 2..108 372 65.1 Plus
Dpse\GA24410-PA 102 GA24410-PA 1..101 1..107 310 54.2 Plus
Dpse\GA21465-PA 113 GA21465-PA 6..112 5..107 244 43.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:10:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19082-PA 108 GM19082-PA 1..108 1..108 577 100 Plus
Dsec\GM14339-PA 122 GM14339-PA 16..121 1..107 365 61.7 Plus
Dsec\GM20415-PA 113 GM20415-PA 6..112 5..107 246 43.9 Plus
Dsec\GM12813-PA 85 GM12813-PA 2..85 21..106 160 34.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:10:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16520-PA 108 GD16520-PA 1..108 1..108 577 100 Plus
Dsim\GD11014-PA 122 GD11014-PA 16..121 1..107 365 61.7 Plus
Dsim\GD25891-PA 113 GD25891-PA 6..112 5..107 246 43.9 Plus
Dsim\GD22391-PA 85 GD22391-PA 2..85 21..106 160 34.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:10:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15825-PA 108 GJ15825-PA 1..108 1..108 558 96.3 Plus
Dvir\GJ16241-PA 149 GJ16241-PA 53..148 12..107 412 77.1 Plus
Dvir\GJ22419-PA 117 GJ22419-PA 27..116 18..107 407 81.1 Plus
Dvir\GJ12485-PA 131 GJ12485-PA 24..131 2..108 373 66.1 Plus
Dvir\GJ15904-PA 104 GJ15904-PA 11..103 14..104 296 55.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:10:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16427-PA 108 GK16427-PA 1..108 1..108 558 96.3 Plus
Dwil\GK15981-PA 112 GK15981-PA 16..112 12..108 476 89.7 Plus
Dwil\GK20831-PA 112 GK20831-PA 16..112 12..108 476 89.7 Plus
Dwil\GK10799-PA 112 GK10799-PA 16..112 12..108 448 84.5 Plus
Dwil\GK18099-PA 160 GK18099-PA 54..159 1..107 429 74.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:10:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16630-PA 111 GE16630-PA 4..111 1..108 560 96.3 Plus
Dyak\GE21084-PA 122 GE21084-PA 16..122 1..108 385 64.8 Plus
Dyak\GE17622-PA 137 GE17622-PA 31..137 1..108 367 63 Plus
Dyak\GE13508-PA 113 GE13508-PA 6..112 5..107 245 43.9 Plus
Dyak\GE10872-PA 85 GE10872-PA 2..85 21..106 160 34.8 Plus