BDGP Sequence Production Resources |
Search the DGRC for SD24044
Library: | SD |
Tissue Source: | Drosophila melanogaster Schneider L2 cell culture |
Created by: | Ling Hong |
Date Registered: | 1999-02-25 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 240 |
Well: | 44 |
Vector: | pOT2 |
Associated Gene/Transcript | MED10-RB |
Protein status: | SD24044.pep: gold |
Preliminary Size: | 480 |
Sequenced Size: | 713 |
Gene | Date | Evidence |
---|---|---|
CG5057 | 2002-01-01 | Sim4 clustering to Release 2 |
CG5057 | 2002-05-30 | Blastp of sequenced clone |
CG5057 | 2003-01-01 | Sim4 clustering to Release 3 |
MED10 | 2008-04-29 | Release 5.5 accounting |
MED10 | 2008-08-15 | Release 5.9 accounting |
MED10 | 2008-12-18 | 5.12 accounting |
713 bp (713 high quality bases) assembled on 2002-05-30
GenBank Submission: AY118450
> SD24044.complete TATTCCTTGCTTATTCGTAAATCCGAATGCTCAAAATTGCGTTTGAGTAG CCCTGGTCATTCGGTGTTTTCTAGAAGAAGAAGAGTTGCGAAGAAAAATA AAATATTTGCCAAGGAAAACAAACATATTAACGAAATACCCACAAAATAA GGAACGAATTTGAATCGTTAAAAATGTCTGCACCGCTAGAGAACCTTGAG ACCCAGCTAGAGATGTTCATCGAGAATGTTCGTCAGATCCGCATAATCGT AAGCGATTTTCAGCCACAGGGTCAAAATGTACTCAACCAGAAAATTAACA GCTTGGTGACCGGCCTACAAGAGATCGACAAGCTGCGCTCCCAGGTGCAG GACGTCTATGTGCCATTTGAAGTGTTTTTTGACTACATCGACCAAGACAA GAATCCTCAGCTGTACACCAAGGATTGCGTGGAGAAGGCACTGGCCAAGA ACGAGGAGGTCAAGGGCAAGATCGAGGGCCTGAAGAAGTTCAAAACGAAT CTGCTGCTGGAGCTGTATAAAACATTTCCCAATGAGATGAACAACTACCG CGCTTATCGCAAGGACTCCATGTAAGGACGTGCTCGAAGGACACGCGACC TGAACTTTAGATTGTAAGCCACATGTTGGAATAAATTTATACTTCTGTAC ATAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
1360 | 3409 | 1360 1360 3409bp | 679..742 | 75..136 | 108 | 65.6 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 16221713..16222007 | 1..295 | 100 | -> | Plus |
chr3L | 16222064..16222420 | 296..652 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
MED10-RA | 1..396 | 174..575 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
MED10-RB | 1..402 | 174..575 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
MED10-RC | 1..402 | 174..575 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
MED10-RA | 1..396 | 174..575 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
MED10-RC | 1..402 | 174..575 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
MED10-RA | 1..646 | 1..652 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
MED10-RB | 1..652 | 1..652 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
MED10-RC | 1..597 | 56..652 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
MED10-RA | 1..646 | 1..652 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
MED10-RC | 1..597 | 56..652 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16232029..16232323 | 1..295 | 100 | -> | Plus |
3L | 16232380..16232736 | 296..652 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16232029..16232323 | 1..295 | 100 | -> | Plus |
3L | 16232380..16232736 | 296..652 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16232029..16232323 | 1..295 | 100 | -> | Plus |
3L | 16232380..16232736 | 296..652 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 16225129..16225423 | 1..295 | 100 | -> | Plus |
arm_3L | 16225480..16225836 | 296..652 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16225129..16225423 | 1..295 | 100 | -> | Plus |
3L | 16225480..16225836 | 296..652 | 100 | Plus |
Translation from 173 to 574
> SD24044.pep MSAPLENLETQLEMFIENVRQIRIIVSDFQPQGQNVLNQKINSLVTGLQE IDKLRSQVQDVYVPFEVFFDYIDQDKNPQLYTKDCVEKALAKNEEVKGKI EGLKKFKTNLLLELYKTFPNEMNNYRAYRKDSM*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24162-PA | 133 | GF24162-PA | 1..133 | 1..133 | 680 | 98.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15965-PA | 261 | GG15965-PA | 1..133 | 1..133 | 695 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15858-PA | 133 | GH15858-PA | 1..133 | 1..133 | 655 | 94 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
MED10-PB | 133 | CG5057-PB | 1..133 | 1..133 | 680 | 100 | Plus |
MED10-PC | 133 | CG5057-PC | 1..133 | 1..133 | 680 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI12641-PA | 133 | GI12641-PA | 1..133 | 1..133 | 643 | 93.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17837-PA | 133 | GL17837-PA | 1..133 | 1..133 | 673 | 97 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA18625-PA | 133 | GA18625-PA | 1..133 | 1..133 | 673 | 97 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25597-PA | 133 | GM25597-PA | 1..133 | 1..133 | 689 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14606-PA | 133 | GD14606-PA | 1..133 | 1..133 | 689 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12760-PA | 133 | GJ12760-PA | 1..133 | 1..133 | 657 | 94.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK16550-PA | 263 | GK16550-PA | 1..95 | 1..95 | 491 | 98.9 | Plus |
Translation from 173 to 574
> SD24044.hyp MSAPLENLETQLEMFIENVRQIRIIVSDFQPQGQNVLNQKINSLVTGLQE IDKLRSQVQDVYVPFEVFFDYIDQDKNPQLYTKDCVEKALAKNEEVKGKI EGLKKFKTNLLLELYKTFPNEMNNYRAYRKDSM*