Clone SD24044 Report

Search the DGRC for SD24044

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:240
Well:44
Vector:pOT2
Associated Gene/TranscriptMED10-RB
Protein status:SD24044.pep: gold
Preliminary Size:480
Sequenced Size:713

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5057 2002-01-01 Sim4 clustering to Release 2
CG5057 2002-05-30 Blastp of sequenced clone
CG5057 2003-01-01 Sim4 clustering to Release 3
MED10 2008-04-29 Release 5.5 accounting
MED10 2008-08-15 Release 5.9 accounting
MED10 2008-12-18 5.12 accounting

Clone Sequence Records

SD24044.complete Sequence

713 bp (713 high quality bases) assembled on 2002-05-30

GenBank Submission: AY118450

> SD24044.complete
TATTCCTTGCTTATTCGTAAATCCGAATGCTCAAAATTGCGTTTGAGTAG
CCCTGGTCATTCGGTGTTTTCTAGAAGAAGAAGAGTTGCGAAGAAAAATA
AAATATTTGCCAAGGAAAACAAACATATTAACGAAATACCCACAAAATAA
GGAACGAATTTGAATCGTTAAAAATGTCTGCACCGCTAGAGAACCTTGAG
ACCCAGCTAGAGATGTTCATCGAGAATGTTCGTCAGATCCGCATAATCGT
AAGCGATTTTCAGCCACAGGGTCAAAATGTACTCAACCAGAAAATTAACA
GCTTGGTGACCGGCCTACAAGAGATCGACAAGCTGCGCTCCCAGGTGCAG
GACGTCTATGTGCCATTTGAAGTGTTTTTTGACTACATCGACCAAGACAA
GAATCCTCAGCTGTACACCAAGGATTGCGTGGAGAAGGCACTGGCCAAGA
ACGAGGAGGTCAAGGGCAAGATCGAGGGCCTGAAGAAGTTCAAAACGAAT
CTGCTGCTGGAGCTGTATAAAACATTTCCCAATGAGATGAACAACTACCG
CGCTTATCGCAAGGACTCCATGTAAGGACGTGCTCGAAGGACACGCGACC
TGAACTTTAGATTGTAAGCCACATGTTGGAATAAATTTATACTTCTGTAC
ATAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAA

SD24044.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:56:35
Subject Length Description Subject Range Query Range Score Percent Strand
MED10-RB 756 MED10-RB 1..656 1..656 3280 100 Plus
MED10.a 646 MED10.a 1..646 1..652 3145 99 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:15:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16222064..16222420 296..652 1785 100 Plus
chr3L 24539361 chr3L 16221713..16222007 1..295 1475 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:58:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:15:51
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16232380..16232740 296..656 1805 100 Plus
3L 28110227 3L 16232029..16232323 1..295 1475 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:28:54
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16225480..16225840 296..656 1805 100 Plus
3L 28103327 3L 16225129..16225423 1..295 1475 100 Plus
Blast to na_te.dros performed 2019-03-16 13:15:51
Subject Length Description Subject Range Query Range Score Percent Strand
1360 3409 1360 1360 3409bp 679..742 75..136 108 65.6 Plus

SD24044.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:16:42 Download gff for SD24044.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16221713..16222007 1..295 100 -> Plus
chr3L 16222064..16222420 296..652 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:10:35 Download gff for SD24044.complete
Subject Subject Range Query Range Percent Splice Strand
MED10-RA 1..396 174..575 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:35:14 Download gff for SD24044.complete
Subject Subject Range Query Range Percent Splice Strand
MED10-RB 1..402 174..575 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:26:15 Download gff for SD24044.complete
Subject Subject Range Query Range Percent Splice Strand
MED10-RC 1..402 174..575 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:26:51 Download gff for SD24044.complete
Subject Subject Range Query Range Percent Splice Strand
MED10-RA 1..396 174..575 98   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:16:10 Download gff for SD24044.complete
Subject Subject Range Query Range Percent Splice Strand
MED10-RC 1..402 174..575 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:06:44 Download gff for SD24044.complete
Subject Subject Range Query Range Percent Splice Strand
MED10-RA 1..646 1..652 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:35:14 Download gff for SD24044.complete
Subject Subject Range Query Range Percent Splice Strand
MED10-RB 1..652 1..652 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:26:15 Download gff for SD24044.complete
Subject Subject Range Query Range Percent Splice Strand
MED10-RC 1..597 56..652 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:26:51 Download gff for SD24044.complete
Subject Subject Range Query Range Percent Splice Strand
MED10-RA 1..646 1..652 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:16:10 Download gff for SD24044.complete
Subject Subject Range Query Range Percent Splice Strand
MED10-RC 1..597 56..652 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:16:42 Download gff for SD24044.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16232029..16232323 1..295 100 -> Plus
3L 16232380..16232736 296..652 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:16:42 Download gff for SD24044.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16232029..16232323 1..295 100 -> Plus
3L 16232380..16232736 296..652 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:16:42 Download gff for SD24044.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16232029..16232323 1..295 100 -> Plus
3L 16232380..16232736 296..652 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:26:15 Download gff for SD24044.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16225129..16225423 1..295 100 -> Plus
arm_3L 16225480..16225836 296..652 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:59:18 Download gff for SD24044.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16225129..16225423 1..295 100 -> Plus
3L 16225480..16225836 296..652 100   Plus

SD24044.pep Sequence

Translation from 173 to 574

> SD24044.pep
MSAPLENLETQLEMFIENVRQIRIIVSDFQPQGQNVLNQKINSLVTGLQE
IDKLRSQVQDVYVPFEVFFDYIDQDKNPQLYTKDCVEKALAKNEEVKGKI
EGLKKFKTNLLLELYKTFPNEMNNYRAYRKDSM*

SD24044.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:44:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24162-PA 133 GF24162-PA 1..133 1..133 680 98.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:44:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15965-PA 261 GG15965-PA 1..133 1..133 695 99.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:44:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15858-PA 133 GH15858-PA 1..133 1..133 655 94 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:04:34
Subject Length Description Subject Range Query Range Score Percent Strand
MED10-PB 133 CG5057-PB 1..133 1..133 680 100 Plus
MED10-PC 133 CG5057-PC 1..133 1..133 680 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:44:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12641-PA 133 GI12641-PA 1..133 1..133 643 93.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:44:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17837-PA 133 GL17837-PA 1..133 1..133 673 97 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:44:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18625-PA 133 GA18625-PA 1..133 1..133 673 97 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:44:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25597-PA 133 GM25597-PA 1..133 1..133 689 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:44:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14606-PA 133 GD14606-PA 1..133 1..133 689 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:44:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12760-PA 133 GJ12760-PA 1..133 1..133 657 94.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:44:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16550-PA 263 GK16550-PA 1..95 1..95 491 98.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:44:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19533-PA 261 GE19533-PA 1..133 1..133 696 99.2 Plus
Dyak\GE23117-PA 261 GE23117-PA 1..133 1..133 695 99.2 Plus

SD24044.hyp Sequence

Translation from 173 to 574

> SD24044.hyp
MSAPLENLETQLEMFIENVRQIRIIVSDFQPQGQNVLNQKINSLVTGLQE
IDKLRSQVQDVYVPFEVFFDYIDQDKNPQLYTKDCVEKALAKNEEVKGKI
EGLKKFKTNLLLELYKTFPNEMNNYRAYRKDSM*

SD24044.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:41:13
Subject Length Description Subject Range Query Range Score Percent Strand
MED10-PB 133 CG5057-PB 1..133 1..133 680 100 Plus
MED10-PC 133 CG5057-PC 1..133 1..133 680 100 Plus