Clone SD24339 Report

Search the DGRC for SD24339

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:243
Well:39
Vector:pOT2
Associated Gene/TranscriptArpc3B-RA
Protein status:SD24339.pep: gold
Preliminary Size:525
Sequenced Size:697

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8936 2002-01-01 Sim4 clustering to Release 2
CG8936 2002-05-18 Blastp of sequenced clone
CG8936 2003-01-01 Sim4 clustering to Release 3
Arpc3B 2008-04-29 Release 5.5 accounting
Arpc3B 2008-08-15 Release 5.9 accounting
Arpc3B 2008-12-18 5.12 accounting

Clone Sequence Records

SD24339.complete Sequence

697 bp (697 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119268

> SD24339.complete
GAAGTTCTGATATATCATATATTACTATATTTTTCGTTTATTTTTAACTT
TTGAAAAACAAGACAGAAGTAATTGAAATGCCGGCATTTCACTCGGAAAT
AGAGGATTTCCAAGCCTCGGTGGGGAATATGGCCCTTCTACCACTACGTA
CCCAAGTCCGAGGACCAGCGCCCACTGTTGATATTCCCAACGACATCATC
GATGAGTCACTCTACTTCTGGAAATCGAACATTTTCTTCCGCACTTACGA
AGTTAAGTCGGAGGTGGACAGGGTGCTCATCTACATAACGCTCTACATCA
CGGAATGTTTGAAGCGATTGGCCCGATGCACAAGCAAATCGCAGGGTCAG
CAGGAGCTCTATACGCTGGCCATCTCGCGGTTCGATATACCCGGAGATGC
GGGATTTCCGCTGAACGGAATATACACCAAGCCCGAGGATCCGGAGCTGA
TGCGTCAGTACTTCCTGCAGTTGCGCCAGGAAACCGGAAACAGATTGCTG
GAAAAGGTCTTCGATACTCCGGATGGAAAGCCGAGCAAGTGGTGGATATG
CTTTGCCAAGAAGAAGTTCATGGAGAAGAGTCTTTCGGGACCGGGAATGT
AAAAGACTCACTAATATACGGCCGATCTTAGAGTATTTACCACCAAAATT
TACGAATAAACTGCTTTGAATGTAAAAAAAAAAAAAAAAAAAAAAAA

SD24339.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:54:41
Subject Length Description Subject Range Query Range Score Percent Strand
Arpc3B-RA 733 Arpc3B-RA 42..715 1..674 3325 99.5 Plus
Arpc3B-RB 838 Arpc3B-RB 229..820 83..674 2930 99.6 Plus
nc_24328.a 481 nc_24328.a 63..479 258..674 2055 99.5 Plus
Arpc3B-RB 838 Arpc3B-RB 34..117 1..84 405 98.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-17 00:00:13
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 16994101..16994518 673..256 2090 100 Minus
chrX 22417052 chrX 16995015..16995189 257..83 875 100 Minus
chrX 22417052 chrX 16995300..16995383 84..1 420 100 Minus
chr3R 27901430 chr3R 11659993..11660153 436..596 325 80.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:58:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 00:00:11
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 17104570..17104988 674..256 2065 99.5 Minus
X 23542271 X 17105483..17105657 257..83 875 100 Minus
X 23542271 X 17105769..17105852 84..1 405 98.8 Minus
3R 32079331 3R 15835384..15835544 436..596 325 80.1 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:13:57
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 17112668..17113086 674..256 2065 99.5 Minus
X 23527363 X 17113581..17113755 257..83 875 100 Minus
X 23527363 X 17113867..17113950 84..1 405 98.8 Minus
3R 31820162 3R 15576215..15576375 436..596 325 80.1 Plus
3R 31820162 3R 15575779..15575911 119..251 155 74.4 Plus
Blast to na_te.dros performed 2019-03-17 00:00:11
Subject Length Description Subject Range Query Range Score Percent Strand
transib4 2656 transib4 TRANSIB4 2656bp 243..299 23..79 122 72.4 Plus
McClintock 6450 McClintock McCLINTOCK 6450bp 1112..1150 57..18 107 77.5 Minus

SD24339.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 00:01:09 Download gff for SD24339.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 16994101..16994516 258..673 100 <- Minus
chrX 16995015..16995188 84..257 100 <- Minus
chrX 16995301..16995383 1..83 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:10:38 Download gff for SD24339.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc3B-RA 1..525 78..602 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:52:03 Download gff for SD24339.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc3B-RA 1..525 78..602 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:27:57 Download gff for SD24339.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc3B-RA 1..525 78..602 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:34:24 Download gff for SD24339.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc3B-RA 1..525 78..602 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:07:30 Download gff for SD24339.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc3B-RA 1..525 78..602 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:03:38 Download gff for SD24339.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc3B-RA 1..671 1..671 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:52:03 Download gff for SD24339.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc3B-RA 1..673 1..673 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:27:57 Download gff for SD24339.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc3B-RA 1..673 1..673 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:34:25 Download gff for SD24339.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc3B-RA 1..671 1..671 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:07:30 Download gff for SD24339.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc3B-RA 1..673 1..673 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:01:09 Download gff for SD24339.complete
Subject Subject Range Query Range Percent Splice Strand
X 17104571..17104986 258..673 99 <- Minus
X 17105483..17105656 84..257 100 <- Minus
X 17105770..17105852 1..83 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:01:09 Download gff for SD24339.complete
Subject Subject Range Query Range Percent Splice Strand
X 17104571..17104986 258..673 99 <- Minus
X 17105483..17105656 84..257 100 <- Minus
X 17105770..17105852 1..83 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:01:09 Download gff for SD24339.complete
Subject Subject Range Query Range Percent Splice Strand
X 17104571..17104986 258..673 99 <- Minus
X 17105483..17105656 84..257 100 <- Minus
X 17105770..17105852 1..83 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:27:57 Download gff for SD24339.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 16998604..16999019 258..673 99 <- Minus
arm_X 16999516..16999689 84..257 100 <- Minus
arm_X 16999803..16999885 1..83 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:15:56 Download gff for SD24339.complete
Subject Subject Range Query Range Percent Splice Strand
X 17113868..17113950 1..83 98   Minus
X 17112669..17113084 258..673 99 <- Minus
X 17113581..17113754 84..257 100 <- Minus

SD24339.hyp Sequence

Translation from 77 to 601

> SD24339.hyp
MPAFHSEIEDFQASVGNMALLPLRTQVRGPAPTVDIPNDIIDESLYFWKS
NIFFRTYEVKSEVDRVLIYITLYITECLKRLARCTSKSQGQQELYTLAIS
RFDIPGDAGFPLNGIYTKPEDPELMRQYFLQLRQETGNRLLEKVFDTPDG
KPSKWWICFAKKKFMEKSLSGPGM*

SD24339.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:36:20
Subject Length Description Subject Range Query Range Score Percent Strand
Arpc3B-PA 174 CG8936-PA 1..174 1..174 922 100 Plus
Arpc3B-PC 157 CG8936-PC 1..157 18..174 833 100 Plus
Arpc3B-PB 157 CG8936-PB 1..157 18..174 833 100 Plus
Arpc3A-PE 177 CG4560-PE 1..176 1..173 721 73.9 Plus
Arpc3A-PC 177 CG4560-PC 1..176 1..173 721 73.9 Plus

SD24339.pep Sequence

Translation from 77 to 601

> SD24339.pep
MPAFHSEIEDFQASVGNMALLPLRTQVRGPAPTVDIPNDIIDESLYFWKS
NIFFRTYEVKSEVDRVLIYITLYITECLKRLARCTSKSQGQQELYTLAIS
RFDIPGDAGFPLNGIYTKPEDPELMRQYFLQLRQETGNRLLEKVFDTPDG
KPSKWWICFAKKKFMEKSLSGPGM*

SD24339.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:26:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18546-PA 177 GF18546-PA 1..176 1..173 766 76.1 Plus
Dana\GF21827-PA 157 GF21827-PA 1..156 18..173 749 87.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:26:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18204-PA 172 GG18204-PA 1..172 1..172 781 84.3 Plus
Dere\GG16957-PA 177 GG16957-PA 1..176 1..173 748 74.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:26:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24637-PA 174 GH24637-PA 1..173 1..173 785 80.3 Plus
Dgri\GH19295-PA 177 GH19295-PA 1..176 1..173 763 76.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:43:44
Subject Length Description Subject Range Query Range Score Percent Strand
Arpc3B-PA 174 CG8936-PA 1..174 1..174 922 100 Plus
Arpc3B-PC 157 CG8936-PC 1..157 18..174 833 100 Plus
Arpc3B-PB 157 CG8936-PB 1..157 18..174 833 100 Plus
Arpc3A-PE 177 CG4560-PE 1..176 1..173 721 73.9 Plus
Arpc3A-PC 177 CG4560-PC 1..176 1..173 721 73.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:26:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23512-PA 177 GI23512-PA 1..176 1..173 773 77.3 Plus
Dmoj\GI15826-PA 173 GI15826-PA 1..173 1..173 767 78.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:26:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22074-PA 177 GL22074-PA 1..176 1..173 765 76.1 Plus
Dper\GL18294-PA 157 GL18294-PA 1..157 18..174 693 79.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:26:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27369-PA 177 GA27369-PA 1..176 1..173 765 76.1 Plus
Dpse\GA27398-PA 157 GA27398-PA 1..157 18..174 693 79.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:26:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24264-PA 177 GM24264-PA 1..176 1..173 745 73.9 Plus
Dsec\GM13341-PA 137 GM13341-PA 1..136 1..136 709 98.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:26:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15703-PA 174 GD15703-PA 1..174 1..174 924 99.4 Plus
Dsim\GD19052-PA 177 GD19052-PA 1..176 1..173 745 73.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:26:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18679-PA 174 GJ18679-PA 1..173 1..173 779 79.2 Plus
Dvir\GJ10263-PA 177 GJ10263-PA 1..176 1..173 772 77.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:26:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17662-PA 174 GK17662-PA 1..174 1..174 757 75.9 Plus
Dwil\GK12788-PA 178 GK12788-PA 1..177 1..173 745 75.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:26:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15621-PA 174 GE15621-PA 1..174 1..174 909 97.1 Plus
Dyak\GE24343-PA 177 GE24343-PA 1..176 1..173 748 74.4 Plus