Clone SD26038 Report

Search the DGRC for SD26038

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:260
Well:38
Vector:pOT2
Associated Gene/TranscriptCG4210-RA
Protein status:SD26038.pep: gold
Preliminary Size:417
Sequenced Size:705

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4210 2002-01-01 Sim4 clustering to Release 2
CG4210 2002-05-19 Blastp of sequenced clone
CG4210 2008-04-29 Release 5.5 accounting
CG4210 2008-08-15 Release 5.9 accounting
CG4210 2008-12-18 5.12 accounting

Clone Sequence Records

SD26038.complete Sequence

705 bp (705 high quality bases) assembled on 2002-05-19

GenBank Submission: AY119275

> SD26038.complete
CAAAAGATAAGCTCTTTTGACCATAATCAGAAAAACACAGGTTATAAAGA
TTTCCCACTATGTCGAAATCCGGAGAGTTTACATTCCGGCGTGCTCTAGC
TGAAGATATTAAAGATGTGCTCTCCATGATTCAAGAACTGGCTGACTTTG
AGAAGATGAGCAATGGTCCCCAGCTAACAGAGGAAGATCTTAAACGAGAC
GCAGGACTCACTGGTGGCCAGGAGTATTGTGAAGTCTATGTGCTTGTAGA
CAACGATACTGATCAGGCGATTGGGTACTCCATTTGCTACAAGGCATACT
CAACGTGGCAGGGACGGTACTTCTTCGTCGAGGACATCTATGTCCGCCCC
GAGCACCGTAAACGCGGCGCCGGAAAGCGAATCTTCTTGGAGGTTGCATC
GCGGGCTGTAGAGCTTCAGTGCCCTCGCCTGGAGTTTAATGTACTGGAAT
GGAATCCTGCACGCAAGTTCTACGAAAGTCTTGGTGCCGTGGATTTGACA
GATAAAGAGGGCTGGCACTACTACCGCGTGGAGGAGCAACAACTGGCCAA
ATTGGCCGCGGATCTGAGGGCAAAAAAATCTTAACTTGATTTGATTTTCA
ATTTTTACTACTTTATAGTAGGGCGATAAATAATTAATAATACTTGGCCA
TGGGCCATATGTGCTATGAGTACATTGCAATTAAAAAAAAAAAAAAAAAA
AAAAA

SD26038.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:59:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG4210-RA 778 CG4210-RA 41..724 1..684 3420 100 Plus
CG4210-RB 802 CG4210-RB 199..748 135..684 2750 100 Plus
CG4210-RB 802 CG4210-RB 3..137 1..135 675 100 Plus
CG6623-RA 3655 CG6623-RA 3557..3655 684..586 495 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:46:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 11039056..11039475 263..682 2100 100 Plus
chr3R 27901430 chr3R 11038604..11038738 1..135 675 100 Plus
chr3R 27901430 chr3R 11038918..11038995 185..262 390 100 Plus
chr3R 27901430 chr3R 11038800..11038851 135..186 260 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:58:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:46:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15214426..15214847 263..684 2110 100 Plus
3R 32079331 3R 15213974..15214108 1..135 675 100 Plus
3R 32079331 3R 15214288..15214365 185..262 390 100 Plus
3R 32079331 3R 15214170..15214221 135..186 260 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:31:45
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 14955257..14955678 263..684 2110 100 Plus
3R 31820162 3R 14954805..14954939 1..135 675 100 Plus
3R 31820162 3R 14955119..14955196 185..262 390 100 Plus
3R 31820162 3R 14955001..14955052 135..186 260 100 Plus
Blast to na_te.dros performed on 2019-03-15 20:46:27 has no hits.

SD26038.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:47:11 Download gff for SD26038.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 11038604..11038737 1..134 100 -> Plus
chr3R 11038800..11038851 135..186 100 -> Plus
chr3R 11038920..11038995 187..262 100 -> Plus
chr3R 11039056..11039475 263..682 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:10:56 Download gff for SD26038.complete
Subject Subject Range Query Range Percent Splice Strand
CG4210-RA 1..525 60..584 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:39:35 Download gff for SD26038.complete
Subject Subject Range Query Range Percent Splice Strand
CG4210-RA 1..525 60..584 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:20:18 Download gff for SD26038.complete
Subject Subject Range Query Range Percent Splice Strand
CG4210-RA 1..525 60..584 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:31:21 Download gff for SD26038.complete
Subject Subject Range Query Range Percent Splice Strand
CG4210-RA 1..525 60..584 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:28:01 Download gff for SD26038.complete
Subject Subject Range Query Range Percent Splice Strand
CG4210-RA 1..525 60..584 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:12:52 Download gff for SD26038.complete
Subject Subject Range Query Range Percent Splice Strand
CG4210-RA 1..646 1..646 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:39:35 Download gff for SD26038.complete
Subject Subject Range Query Range Percent Splice Strand
CG4210-RA 1..646 1..646 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:20:18 Download gff for SD26038.complete
Subject Subject Range Query Range Percent Splice Strand
CG4210-RA 1..682 1..682 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:31:21 Download gff for SD26038.complete
Subject Subject Range Query Range Percent Splice Strand
CG4210-RA 1..646 1..646 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:28:01 Download gff for SD26038.complete
Subject Subject Range Query Range Percent Splice Strand
CG4210-RA 1..682 1..682 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:47:11 Download gff for SD26038.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15213974..15214107 1..134 100 -> Plus
3R 15214170..15214221 135..186 100 -> Plus
3R 15214290..15214365 187..262 100 -> Plus
3R 15214426..15214845 263..682 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:47:11 Download gff for SD26038.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15213974..15214107 1..134 100 -> Plus
3R 15214170..15214221 135..186 100 -> Plus
3R 15214290..15214365 187..262 100 -> Plus
3R 15214426..15214845 263..682 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:47:11 Download gff for SD26038.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15213974..15214107 1..134 100 -> Plus
3R 15214170..15214221 135..186 100 -> Plus
3R 15214290..15214365 187..262 100 -> Plus
3R 15214426..15214845 263..682 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:20:18 Download gff for SD26038.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11039696..11039829 1..134 100 -> Plus
arm_3R 11039892..11039943 135..186 100 -> Plus
arm_3R 11040012..11040087 187..262 100 -> Plus
arm_3R 11040148..11040567 263..682 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:03:57 Download gff for SD26038.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14955257..14955676 263..682 100   Plus
3R 14954805..14954938 1..134 100 -> Plus
3R 14955001..14955052 135..186 100 -> Plus
3R 14955121..14955196 187..262 100 -> Plus

SD26038.hyp Sequence

Translation from 59 to 583

> SD26038.hyp
MSKSGEFTFRRALAEDIKDVLSMIQELADFEKMSNGPQLTEEDLKRDAGL
TGGQEYCEVYVLVDNDTDQAIGYSICYKAYSTWQGRYFFVEDIYVRPEHR
KRGAGKRIFLEVASRAVELQCPRLEFNVLEWNPARKFYESLGAVDLTDKE
GWHYYRVEEQQLAKLAADLRAKKS*

SD26038.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:39:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG4210-PA 174 CG4210-PA 1..174 1..174 912 100 Plus

SD26038.pep Sequence

Translation from 59 to 583

> SD26038.pep
MSKSGEFTFRRALAEDIKDVLSMIQELADFEKMSNGPQLTEEDLKRDAGL
TGGQEYCEVYVLVDNDTDQAIGYSICYKAYSTWQGRYFFVEDIYVRPEHR
KRGAGKRIFLEVASRAVELQCPRLEFNVLEWNPARKFYESLGAVDLTDKE
GWHYYRVEEQQLAKLAADLRAKKS*

SD26038.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:06:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11334-PA 174 GF11334-PA 1..174 1..174 809 87.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:06:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16894-PA 174 GG16894-PA 1..173 1..173 865 93.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 04:06:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18843-PA 171 GH18843-PA 1..169 1..169 609 66.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:51:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG4210-PA 174 CG4210-PA 1..174 1..174 912 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 04:06:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10105-PA 171 GI10105-PA 1..171 1..171 593 62.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:06:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12409-PA 170 GL12409-PA 1..169 1..169 794 86.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:06:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18034-PA 174 GA18034-PA 1..174 1..174 807 85.6 Plus
Dpse\GA27656-PA 174 GA27656-PA 1..174 1..174 807 85.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:06:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24203-PA 174 GM24203-PA 1..174 1..174 909 97.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:06:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18993-PA 174 GD18993-PA 1..174 1..174 892 95.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:06:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23842-PA 171 GJ23842-PA 1..169 1..169 639 68 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:06:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11862-PA 166 GK11862-PA 2..162 7..166 554 64.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:06:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24276-PA 174 GE24276-PA 1..174 1..174 874 93.1 Plus