BDGP Sequence Production Resources |
Search the DGRC for SD26038
Library: | SD |
Tissue Source: | Drosophila melanogaster Schneider L2 cell culture |
Created by: | Ling Hong |
Date Registered: | 1999-02-25 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 260 |
Well: | 38 |
Vector: | pOT2 |
Associated Gene/Transcript | CG4210-RA |
Protein status: | SD26038.pep: gold |
Preliminary Size: | 417 |
Sequenced Size: | 705 |
Gene | Date | Evidence |
---|---|---|
CG4210 | 2002-01-01 | Sim4 clustering to Release 2 |
CG4210 | 2002-05-19 | Blastp of sequenced clone |
CG4210 | 2008-04-29 | Release 5.5 accounting |
CG4210 | 2008-08-15 | Release 5.9 accounting |
CG4210 | 2008-12-18 | 5.12 accounting |
705 bp (705 high quality bases) assembled on 2002-05-19
GenBank Submission: AY119275
> SD26038.complete CAAAAGATAAGCTCTTTTGACCATAATCAGAAAAACACAGGTTATAAAGA TTTCCCACTATGTCGAAATCCGGAGAGTTTACATTCCGGCGTGCTCTAGC TGAAGATATTAAAGATGTGCTCTCCATGATTCAAGAACTGGCTGACTTTG AGAAGATGAGCAATGGTCCCCAGCTAACAGAGGAAGATCTTAAACGAGAC GCAGGACTCACTGGTGGCCAGGAGTATTGTGAAGTCTATGTGCTTGTAGA CAACGATACTGATCAGGCGATTGGGTACTCCATTTGCTACAAGGCATACT CAACGTGGCAGGGACGGTACTTCTTCGTCGAGGACATCTATGTCCGCCCC GAGCACCGTAAACGCGGCGCCGGAAAGCGAATCTTCTTGGAGGTTGCATC GCGGGCTGTAGAGCTTCAGTGCCCTCGCCTGGAGTTTAATGTACTGGAAT GGAATCCTGCACGCAAGTTCTACGAAAGTCTTGGTGCCGTGGATTTGACA GATAAAGAGGGCTGGCACTACTACCGCGTGGAGGAGCAACAACTGGCCAA ATTGGCCGCGGATCTGAGGGCAAAAAAATCTTAACTTGATTTGATTTTCA ATTTTTACTACTTTATAGTAGGGCGATAAATAATTAATAATACTTGGCCA TGGGCCATATGTGCTATGAGTACATTGCAATTAAAAAAAAAAAAAAAAAA AAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG4210-RA | 778 | CG4210-RA | 41..724 | 1..684 | 3420 | 100 | Plus |
CG4210-RB | 802 | CG4210-RB | 199..748 | 135..684 | 2750 | 100 | Plus |
CG4210-RB | 802 | CG4210-RB | 3..137 | 1..135 | 675 | 100 | Plus |
CG6623-RA | 3655 | CG6623-RA | 3557..3655 | 684..586 | 495 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 11039056..11039475 | 263..682 | 2100 | 100 | Plus |
chr3R | 27901430 | chr3R | 11038604..11038738 | 1..135 | 675 | 100 | Plus |
chr3R | 27901430 | chr3R | 11038918..11038995 | 185..262 | 390 | 100 | Plus |
chr3R | 27901430 | chr3R | 11038800..11038851 | 135..186 | 260 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 15214426..15214847 | 263..684 | 2110 | 100 | Plus |
3R | 32079331 | 3R | 15213974..15214108 | 1..135 | 675 | 100 | Plus |
3R | 32079331 | 3R | 15214288..15214365 | 185..262 | 390 | 100 | Plus |
3R | 32079331 | 3R | 15214170..15214221 | 135..186 | 260 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 14955257..14955678 | 263..684 | 2110 | 100 | Plus |
3R | 31820162 | 3R | 14954805..14954939 | 1..135 | 675 | 100 | Plus |
3R | 31820162 | 3R | 14955119..14955196 | 185..262 | 390 | 100 | Plus |
3R | 31820162 | 3R | 14955001..14955052 | 135..186 | 260 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 11038604..11038737 | 1..134 | 100 | -> | Plus |
chr3R | 11038800..11038851 | 135..186 | 100 | -> | Plus |
chr3R | 11038920..11038995 | 187..262 | 100 | -> | Plus |
chr3R | 11039056..11039475 | 263..682 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4210-RA | 1..525 | 60..584 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4210-RA | 1..525 | 60..584 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4210-RA | 1..525 | 60..584 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4210-RA | 1..525 | 60..584 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4210-RA | 1..525 | 60..584 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4210-RA | 1..646 | 1..646 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4210-RA | 1..646 | 1..646 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4210-RA | 1..682 | 1..682 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4210-RA | 1..646 | 1..646 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4210-RA | 1..682 | 1..682 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 15213974..15214107 | 1..134 | 100 | -> | Plus |
3R | 15214170..15214221 | 135..186 | 100 | -> | Plus |
3R | 15214290..15214365 | 187..262 | 100 | -> | Plus |
3R | 15214426..15214845 | 263..682 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 15213974..15214107 | 1..134 | 100 | -> | Plus |
3R | 15214170..15214221 | 135..186 | 100 | -> | Plus |
3R | 15214290..15214365 | 187..262 | 100 | -> | Plus |
3R | 15214426..15214845 | 263..682 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 15213974..15214107 | 1..134 | 100 | -> | Plus |
3R | 15214170..15214221 | 135..186 | 100 | -> | Plus |
3R | 15214290..15214365 | 187..262 | 100 | -> | Plus |
3R | 15214426..15214845 | 263..682 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 11039696..11039829 | 1..134 | 100 | -> | Plus |
arm_3R | 11039892..11039943 | 135..186 | 100 | -> | Plus |
arm_3R | 11040012..11040087 | 187..262 | 100 | -> | Plus |
arm_3R | 11040148..11040567 | 263..682 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 14955257..14955676 | 263..682 | 100 | Plus | |
3R | 14954805..14954938 | 1..134 | 100 | -> | Plus |
3R | 14955001..14955052 | 135..186 | 100 | -> | Plus |
3R | 14955121..14955196 | 187..262 | 100 | -> | Plus |
Translation from 59 to 583
> SD26038.hyp MSKSGEFTFRRALAEDIKDVLSMIQELADFEKMSNGPQLTEEDLKRDAGL TGGQEYCEVYVLVDNDTDQAIGYSICYKAYSTWQGRYFFVEDIYVRPEHR KRGAGKRIFLEVASRAVELQCPRLEFNVLEWNPARKFYESLGAVDLTDKE GWHYYRVEEQQLAKLAADLRAKKS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG4210-PA | 174 | CG4210-PA | 1..174 | 1..174 | 912 | 100 | Plus |
Translation from 59 to 583
> SD26038.pep MSKSGEFTFRRALAEDIKDVLSMIQELADFEKMSNGPQLTEEDLKRDAGL TGGQEYCEVYVLVDNDTDQAIGYSICYKAYSTWQGRYFFVEDIYVRPEHR KRGAGKRIFLEVASRAVELQCPRLEFNVLEWNPARKFYESLGAVDLTDKE GWHYYRVEEQQLAKLAADLRAKKS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF11334-PA | 174 | GF11334-PA | 1..174 | 1..174 | 809 | 87.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG16894-PA | 174 | GG16894-PA | 1..173 | 1..173 | 865 | 93.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18843-PA | 171 | GH18843-PA | 1..169 | 1..169 | 609 | 66.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG4210-PA | 174 | CG4210-PA | 1..174 | 1..174 | 912 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI10105-PA | 171 | GI10105-PA | 1..171 | 1..171 | 593 | 62.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL12409-PA | 170 | GL12409-PA | 1..169 | 1..169 | 794 | 86.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA18034-PA | 174 | GA18034-PA | 1..174 | 1..174 | 807 | 85.6 | Plus |
Dpse\GA27656-PA | 174 | GA27656-PA | 1..174 | 1..174 | 807 | 85.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM24203-PA | 174 | GM24203-PA | 1..174 | 1..174 | 909 | 97.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD18993-PA | 174 | GD18993-PA | 1..174 | 1..174 | 892 | 95.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23842-PA | 171 | GJ23842-PA | 1..169 | 1..169 | 639 | 68 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK11862-PA | 166 | GK11862-PA | 2..162 | 7..166 | 554 | 64.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE24276-PA | 174 | GE24276-PA | 1..174 | 1..174 | 874 | 93.1 | Plus |