BDGP Sequence Production Resources |
Search the DGRC for SD26403
Library: | SD |
Tissue Source: | Drosophila melanogaster Schneider L2 cell culture |
Created by: | Ling Hong |
Date Registered: | 1999-02-25 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 264 |
Well: | 3 |
Vector: | pOT2 |
Associated Gene/Transcript | dgt4-RA |
Protein status: | SD26403.pep: gold |
Preliminary Size: | 603 |
Sequenced Size: | 730 |
Gene | Date | Evidence |
---|---|---|
CG4865 | 2002-01-01 | Sim4 clustering to Release 2 |
CG4865 | 2002-05-19 | Blastp of sequenced clone |
CG4865 | 2003-01-01 | Sim4 clustering to Release 3 |
dgt4 | 2008-04-29 | Release 5.5 accounting |
dgt4 | 2008-08-15 | Release 5.9 accounting |
dgt4 | 2008-12-18 | 5.12 accounting |
730 bp (730 high quality bases) assembled on 2002-05-19
GenBank Submission: AY119277
> SD26403.complete AAAGCGATAGCGTCGGCAATCGAATCCGAATTTCCCACTTTAAAAACTAA GAAGTTTTTGTAAGCCACTATGGAAACTCCACCCACTCCCACCACGACCA CACCGCCATCATTGACAACTGAGGGCACCATGGACGACATCCAATACCTG CTGCACCTGGAGGCGATGCGCCGTTTTCAGGAAGACAGCCGCAATGTAAA GCGCCAGGTGGAGGAGCAAGTACGCATTTGGCTGGACGCCAAGTGTGAGT ATCAGCGGGACTTTGGGCGGCTGGCGAGGCTCCTGAAGTGCGGAGCCCTG CAGGCGGCCGTGGATGCCCATCGTGTATCTGATGTGAATCAAGTCGACCA GGCGGCCAAGGATATCGCTAGTTTGCGATCCAAACTGGGCAGTGATCTGC GTCCCGCCATTCTGGACTCCAACGATGTGAAGCAGTGCCTGGAACATCTG AACACCACCCACAAACCGCGCCTAAATCTATGCCGGCAACAACGGGAGTT CGCCCAGAACCAAGAAGCTCTAAGAAGTTTGCGTACCGCCGTCGATGGAT TGGAGAATGGTATGGAGATGGGCATGATACAGGCAATGGACCGCCTTGTG GAGGATCTTCTCCCACCGCGGGAAACAAACAACTAGCCGGTCGTCTCAAA AGTATATATAATATTGTATGATATAAACTAGTTTATAACATTAAAAACGG AAACTGTAAATGAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chrX | 22417052 | chrX | 4007384..4008095 | 1..712 | 3560 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23542271 | X | 4114159..4114874 | 1..716 | 3580 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23527363 | X | 4122257..4122972 | 1..716 | 3580 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 4007384..4008095 | 1..712 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
dgt4-RA | 1..567 | 70..636 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
dgt4-RA | 1..567 | 70..636 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
dgt4-RA | 1..567 | 70..636 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
dgt4-RA | 1..567 | 70..636 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
dgt4-RA | 1..567 | 70..636 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
dgt4-RA | 1..712 | 1..712 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
dgt4-RA | 1..712 | 1..712 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
dgt4-RA | 18..729 | 1..712 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
dgt4-RA | 1..712 | 1..712 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
dgt4-RA | 18..729 | 1..712 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 4114159..4114870 | 1..712 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 4114159..4114870 | 1..712 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 4114159..4114870 | 1..712 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 4008192..4008903 | 1..712 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 4122257..4122968 | 1..712 | 100 | Plus |
Translation from 69 to 635
> SD26403.hyp METPPTPTTTTPPSLTTEGTMDDIQYLLHLEAMRRFQEDSRNVKRQVEEQ VRIWLDAKCEYQRDFGRLARLLKCGALQAAVDAHRVSDVNQVDQAAKDIA SLRSKLGSDLRPAILDSNDVKQCLEHLNTTHKPRLNLCRQQREFAQNQEA LRSLRTAVDGLENGMEMGMIQAMDRLVEDLLPPRETNN*
Translation from 69 to 635
> SD26403.pep METPPTPTTTTPPSLTTEGTMDDIQYLLHLEAMRRFQEDSRNVKRQVEEQ VRIWLDAKCEYQRDFGRLARLLKCGALQAAVDAHRVSDVNQVDQAAKDIA SLRSKLGSDLRPAILDSNDVKQCLEHLNTTHKPRLNLCRQQREFAQNQEA LRSLRTAVDGLENGMEMGMIQAMDRLVEDLLPPRETNN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF20778-PA | 185 | GF20778-PA | 1..175 | 1..182 | 519 | 54.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\EG:EG0007.10-PA | 201 | GG18693-PA | 1..185 | 1..185 | 753 | 84.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH24146-PA | 190 | GH24146-PA | 12..174 | 22..183 | 308 | 40.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
dgt4-PC | 188 | CG4865-PC | 1..188 | 1..188 | 969 | 100 | Plus |
dgt4-PB | 188 | CG4865-PB | 1..188 | 1..188 | 969 | 100 | Plus |
dgt4-PA | 188 | CG4865-PA | 1..188 | 1..188 | 969 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI16400-PA | 173 | GI16400-PA | 6..171 | 16..183 | 288 | 36 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL21391-PA | 184 | GL21391-PA | 6..177 | 15..186 | 384 | 45.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA18488-PA | 184 | GA18488-PA | 6..177 | 15..186 | 398 | 46.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM12326-PA | 188 | GM12326-PA | 1..188 | 1..188 | 982 | 97.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\EG:EG0007.10-PA | 188 | GD16671-PA | 1..188 | 1..188 | 982 | 97.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ17021-PA | 177 | GJ17021-PA | 6..175 | 16..184 | 332 | 38.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK15581-PA | 194 | GK15581-PA | 21..194 | 16..188 | 241 | 35 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\EG:EG0007.10-PA | 188 | GE16332-PA | 1..188 | 1..188 | 815 | 89.9 | Plus |