Clone SD26403 Report

Search the DGRC for SD26403

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:264
Well:3
Vector:pOT2
Associated Gene/Transcriptdgt4-RA
Protein status:SD26403.pep: gold
Preliminary Size:603
Sequenced Size:730

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4865 2002-01-01 Sim4 clustering to Release 2
CG4865 2002-05-19 Blastp of sequenced clone
CG4865 2003-01-01 Sim4 clustering to Release 3
dgt4 2008-04-29 Release 5.5 accounting
dgt4 2008-08-15 Release 5.9 accounting
dgt4 2008-12-18 5.12 accounting

Clone Sequence Records

SD26403.complete Sequence

730 bp (730 high quality bases) assembled on 2002-05-19

GenBank Submission: AY119277

> SD26403.complete
AAAGCGATAGCGTCGGCAATCGAATCCGAATTTCCCACTTTAAAAACTAA
GAAGTTTTTGTAAGCCACTATGGAAACTCCACCCACTCCCACCACGACCA
CACCGCCATCATTGACAACTGAGGGCACCATGGACGACATCCAATACCTG
CTGCACCTGGAGGCGATGCGCCGTTTTCAGGAAGACAGCCGCAATGTAAA
GCGCCAGGTGGAGGAGCAAGTACGCATTTGGCTGGACGCCAAGTGTGAGT
ATCAGCGGGACTTTGGGCGGCTGGCGAGGCTCCTGAAGTGCGGAGCCCTG
CAGGCGGCCGTGGATGCCCATCGTGTATCTGATGTGAATCAAGTCGACCA
GGCGGCCAAGGATATCGCTAGTTTGCGATCCAAACTGGGCAGTGATCTGC
GTCCCGCCATTCTGGACTCCAACGATGTGAAGCAGTGCCTGGAACATCTG
AACACCACCCACAAACCGCGCCTAAATCTATGCCGGCAACAACGGGAGTT
CGCCCAGAACCAAGAAGCTCTAAGAAGTTTGCGTACCGCCGTCGATGGAT
TGGAGAATGGTATGGAGATGGGCATGATACAGGCAATGGACCGCCTTGTG
GAGGATCTTCTCCCACCGCGGGAAACAAACAACTAGCCGGTCGTCTCAAA
AGTATATATAATATTGTATGATATAAACTAGTTTATAACATTAAAAACGG
AAACTGTAAATGAAAAAAAAAAAAAAAAAA

SD26403.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:59:46
Subject Length Description Subject Range Query Range Score Percent Strand
dgt4.b 955 dgt4.b 244..955 1..712 3560 100 Plus
dgt4.a 986 dgt4.a 275..986 1..712 3560 100 Plus
dgt4-RA 712 dgt4-RA 1..712 1..712 3560 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:46:36
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 4007384..4008095 1..712 3560 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:58:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:46:33
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4114159..4114874 1..716 3580 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:31:47
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 4122257..4122972 1..716 3580 100 Plus
Blast to na_te.dros performed on 2019-03-16 08:46:34 has no hits.

SD26403.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:47:34 Download gff for SD26403.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 4007384..4008095 1..712 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:11:00 Download gff for SD26403.complete
Subject Subject Range Query Range Percent Splice Strand
dgt4-RA 1..567 70..636 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:39:37 Download gff for SD26403.complete
Subject Subject Range Query Range Percent Splice Strand
dgt4-RA 1..567 70..636 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:53:34 Download gff for SD26403.complete
Subject Subject Range Query Range Percent Splice Strand
dgt4-RA 1..567 70..636 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:31:23 Download gff for SD26403.complete
Subject Subject Range Query Range Percent Splice Strand
dgt4-RA 1..567 70..636 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:50:16 Download gff for SD26403.complete
Subject Subject Range Query Range Percent Splice Strand
dgt4-RA 1..567 70..636 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:12:55 Download gff for SD26403.complete
Subject Subject Range Query Range Percent Splice Strand
dgt4-RA 1..712 1..712 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:39:37 Download gff for SD26403.complete
Subject Subject Range Query Range Percent Splice Strand
dgt4-RA 1..712 1..712 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:53:34 Download gff for SD26403.complete
Subject Subject Range Query Range Percent Splice Strand
dgt4-RA 18..729 1..712 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:31:24 Download gff for SD26403.complete
Subject Subject Range Query Range Percent Splice Strand
dgt4-RA 1..712 1..712 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:50:16 Download gff for SD26403.complete
Subject Subject Range Query Range Percent Splice Strand
dgt4-RA 18..729 1..712 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:47:34 Download gff for SD26403.complete
Subject Subject Range Query Range Percent Splice Strand
X 4114159..4114870 1..712 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:47:34 Download gff for SD26403.complete
Subject Subject Range Query Range Percent Splice Strand
X 4114159..4114870 1..712 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:47:34 Download gff for SD26403.complete
Subject Subject Range Query Range Percent Splice Strand
X 4114159..4114870 1..712 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:53:34 Download gff for SD26403.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 4008192..4008903 1..712 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:04:00 Download gff for SD26403.complete
Subject Subject Range Query Range Percent Splice Strand
X 4122257..4122968 1..712 100   Plus

SD26403.hyp Sequence

Translation from 69 to 635

> SD26403.hyp
METPPTPTTTTPPSLTTEGTMDDIQYLLHLEAMRRFQEDSRNVKRQVEEQ
VRIWLDAKCEYQRDFGRLARLLKCGALQAAVDAHRVSDVNQVDQAAKDIA
SLRSKLGSDLRPAILDSNDVKQCLEHLNTTHKPRLNLCRQQREFAQNQEA
LRSLRTAVDGLENGMEMGMIQAMDRLVEDLLPPRETNN*

SD26403.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:41:08
Subject Length Description Subject Range Query Range Score Percent Strand
dgt4-PC 188 CG4865-PC 1..188 1..188 969 100 Plus
dgt4-PB 188 CG4865-PB 1..188 1..188 969 100 Plus
dgt4-PA 188 CG4865-PA 1..188 1..188 969 100 Plus

SD26403.pep Sequence

Translation from 69 to 635

> SD26403.pep
METPPTPTTTTPPSLTTEGTMDDIQYLLHLEAMRRFQEDSRNVKRQVEEQ
VRIWLDAKCEYQRDFGRLARLLKCGALQAAVDAHRVSDVNQVDQAAKDIA
SLRSKLGSDLRPAILDSNDVKQCLEHLNTTHKPRLNLCRQQREFAQNQEA
LRSLRTAVDGLENGMEMGMIQAMDRLVEDLLPPRETNN*

SD26403.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:06:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20778-PA 185 GF20778-PA 1..175 1..182 519 54.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:06:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\EG:EG0007.10-PA 201 GG18693-PA 1..185 1..185 753 84.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 04:06:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24146-PA 190 GH24146-PA 12..174 22..183 308 40.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:24:47
Subject Length Description Subject Range Query Range Score Percent Strand
dgt4-PC 188 CG4865-PC 1..188 1..188 969 100 Plus
dgt4-PB 188 CG4865-PB 1..188 1..188 969 100 Plus
dgt4-PA 188 CG4865-PA 1..188 1..188 969 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 04:06:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16400-PA 173 GI16400-PA 6..171 16..183 288 36 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:06:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21391-PA 184 GL21391-PA 6..177 15..186 384 45.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:06:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18488-PA 184 GA18488-PA 6..177 15..186 398 46.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:06:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12326-PA 188 GM12326-PA 1..188 1..188 982 97.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:06:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\EG:EG0007.10-PA 188 GD16671-PA 1..188 1..188 982 97.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:06:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17021-PA 177 GJ17021-PA 6..175 16..184 332 38.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:06:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15581-PA 194 GK15581-PA 21..194 16..188 241 35 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:06:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\EG:EG0007.10-PA 188 GE16332-PA 1..188 1..188 815 89.9 Plus