BDGP Sequence Production Resources |
Search the DGRC for SD27354
Library: | SD |
Tissue Source: | Drosophila melanogaster Schneider L2 cell culture |
Created by: | Ling Hong |
Date Registered: | 1999-02-25 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 273 |
Well: | 54 |
Vector: | pOT2 |
Associated Gene/Transcript | l(3)87Df-RA |
Protein status: | SD27354.pep: gold |
Preliminary Size: | 333 |
Sequenced Size: | 545 |
Gene | Date | Evidence |
---|---|---|
CG7620 | 2002-01-01 | Sim4 clustering to Release 2 |
CG7620 | 2002-05-19 | Blastp of sequenced clone |
CG7620 | 2003-01-01 | Sim4 clustering to Release 3 |
l(3)87Df | 2008-04-29 | Release 5.5 accounting |
l(3)87Df | 2008-08-15 | Release 5.9 accounting |
l(3)87Df | 2008-12-18 | 5.12 accounting |
545 bp (545 high quality bases) assembled on 2002-05-19
GenBank Submission: AY119283
> SD27354.complete TTTTGCTTTGCAACTCGACTTTTAAAATTGCAATTGCAGCATGGCCGAAG AACCCGAGGAACCCGCCAAGAGCTTCGTTATCTTCGGACGCGATGTGGCG CAGATCCCGTGCTTTCGTAACAGTTTTCTCTACGGAATCAGCGGAGGGAT CGGCATCGGCTTGCTGACTTTTCTGGGCACCTCGCGAACCCACCTGTCCA CCCACGTGGGCTTCGGCTCCTTCTTCTGCGGCACCATCGCCTACTGGATG ACCTGCAGGTATCAATGGTCCGTCAGGAGATTCGAGCAGCAGCAATTGCG TGAGGCGATGAGACGACAAGCCCTTTATGAGGGCACCCAAAGGGAGAGAG ACTTAGATCTGAAGTCGGCGTAGCATAAGTCAGATCCTTCATTACTACTT CGATGTTTGTTTTCACTCTAGGATACCAAGTAATCCTGGCATTGTCAAAT CCCTTGTGTTGTAAACTACCTTTTGTTACCAAACTTTATAGTAGCCAATA TATTATATATATGTTGTAAGTGAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 8856557..8856824 | 255..522 | 1340 | 100 | Plus |
chr3R | 27901430 | chr3R | 8856306..8856498 | 69..261 | 965 | 100 | Plus |
chr3R | 27901430 | chr3R | 8856168..8856237 | 1..70 | 350 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 13031331..13031601 | 255..525 | 1340 | 99.6 | Plus |
3R | 32079331 | 3R | 13031080..13031272 | 69..261 | 950 | 99.5 | Plus |
3R | 32079331 | 3R | 13030942..13031011 | 1..70 | 335 | 98.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 12772162..12772432 | 255..525 | 1340 | 99.6 | Plus |
3R | 31820162 | 3R | 12771911..12772103 | 69..261 | 950 | 99.4 | Plus |
3R | 31820162 | 3R | 12771773..12771842 | 1..70 | 335 | 98.5 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 8856168..8856237 | 1..70 | 100 | -> | Plus |
chr3R | 8856308..8856495 | 71..258 | 100 | -> | Plus |
chr3R | 8856561..8856824 | 259..522 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(3)87Df-RA | 1..333 | 41..373 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(3)87Df-RA | 1..333 | 41..373 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(3)87Df-RA | 1..333 | 41..373 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(3)87Df-RA | 1..333 | 41..373 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(3)87Df-RA | 1..333 | 41..373 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(3)87Df-RA | 1..519 | 1..519 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(3)87Df-RA | 1..519 | 1..519 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(3)87Df-RA | 30..551 | 1..522 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(3)87Df-RA | 1..519 | 1..519 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(3)87Df-RA | 30..551 | 1..522 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 13030942..13031011 | 1..70 | 98 | -> | Plus |
3R | 13031082..13031269 | 71..258 | 99 | -> | Plus |
3R | 13031335..13031598 | 259..522 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 13030942..13031011 | 1..70 | 98 | -> | Plus |
3R | 13031082..13031269 | 71..258 | 99 | -> | Plus |
3R | 13031335..13031598 | 259..522 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 13030942..13031011 | 1..70 | 98 | -> | Plus |
3R | 13031082..13031269 | 71..258 | 99 | -> | Plus |
3R | 13031335..13031598 | 259..522 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 8856664..8856733 | 1..70 | 98 | -> | Plus |
arm_3R | 8856804..8856991 | 71..258 | 99 | -> | Plus |
arm_3R | 8857057..8857320 | 259..522 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 12772166..12772429 | 259..522 | 99 | Plus | |
3R | 12771773..12771842 | 1..70 | 98 | -> | Plus |
3R | 12771913..12772100 | 71..258 | 99 | -> | Plus |
Translation from 40 to 372
> SD27354.pep MAEEPEEPAKSFVIFGRDVAQIPCFRNSFLYGISGGIGIGLLTFLGTSRT HLSTHVGFGSFFCGTIAYWMTCRYQWSVRRFEQQQLREAMRRQALYEGTQ RERDLDLKSA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF16929-PA | 110 | GF16929-PA | 1..110 | 1..110 | 482 | 90.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG19368-PA | 110 | GG19368-PA | 1..110 | 1..110 | 507 | 95.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18369-PA | 110 | GH18369-PA | 1..110 | 1..110 | 456 | 83.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
l(3)87Df-PA | 110 | CG7620-PA | 1..110 | 1..110 | 584 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23358-PA | 111 | GI23358-PA | 2..111 | 1..110 | 454 | 82.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24382-PA | 110 | GL24382-PA | 1..110 | 1..110 | 493 | 91.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\l(3)87Df-PA | 110 | GA26595-PA | 1..110 | 1..110 | 493 | 91.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM24077-PA | 110 | GM24077-PA | 1..110 | 1..110 | 575 | 98.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD18874-PA | 110 | GD18874-PA | 1..110 | 1..110 | 581 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ10352-PA | 110 | GJ10352-PA | 1..110 | 1..110 | 456 | 83.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK12224-PA | 110 | GK12224-PA | 1..110 | 1..110 | 478 | 87.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE26235-PA | 110 | GE26235-PA | 1..110 | 1..110 | 506 | 95.5 | Plus |
Translation from 40 to 372
> SD27354.hyp MAEEPEEPAKSFVIFGRDVAQIPCFRNSFLYGISGGIGIGLLTFLGTSRT HLSTHVGFGSFFCGTIAYWMTCRYQWSVRRFEQQQLREAMRRQALYEGTQ RERDLDLKSA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
l(3)87Df-PA | 110 | CG7620-PA | 1..110 | 1..110 | 584 | 100 | Plus |