Clone SD27354 Report

Search the DGRC for SD27354

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:273
Well:54
Vector:pOT2
Associated Gene/Transcriptl(3)87Df-RA
Protein status:SD27354.pep: gold
Preliminary Size:333
Sequenced Size:545

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7620 2002-01-01 Sim4 clustering to Release 2
CG7620 2002-05-19 Blastp of sequenced clone
CG7620 2003-01-01 Sim4 clustering to Release 3
l(3)87Df 2008-04-29 Release 5.5 accounting
l(3)87Df 2008-08-15 Release 5.9 accounting
l(3)87Df 2008-12-18 5.12 accounting

Clone Sequence Records

SD27354.complete Sequence

545 bp (545 high quality bases) assembled on 2002-05-19

GenBank Submission: AY119283

> SD27354.complete
TTTTGCTTTGCAACTCGACTTTTAAAATTGCAATTGCAGCATGGCCGAAG
AACCCGAGGAACCCGCCAAGAGCTTCGTTATCTTCGGACGCGATGTGGCG
CAGATCCCGTGCTTTCGTAACAGTTTTCTCTACGGAATCAGCGGAGGGAT
CGGCATCGGCTTGCTGACTTTTCTGGGCACCTCGCGAACCCACCTGTCCA
CCCACGTGGGCTTCGGCTCCTTCTTCTGCGGCACCATCGCCTACTGGATG
ACCTGCAGGTATCAATGGTCCGTCAGGAGATTCGAGCAGCAGCAATTGCG
TGAGGCGATGAGACGACAAGCCCTTTATGAGGGCACCCAAAGGGAGAGAG
ACTTAGATCTGAAGTCGGCGTAGCATAAGTCAGATCCTTCATTACTACTT
CGATGTTTGTTTTCACTCTAGGATACCAAGTAATCCTGGCATTGTCAAAT
CCCTTGTGTTGTAAACTACCTTTTGTTACCAAACTTTATAGTAGCCAATA
TATTATATATATGTTGTAAGTGAAAAAAAAAAAAAAAAAAAAAAA

SD27354.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:59:40
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)87Df-RA 898 l(3)87Df-RA 34..558 1..525 2580 99.4 Plus
l(3)87Df.a 898 l(3)87Df.a 34..558 1..525 2580 99.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:28:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8856557..8856824 255..522 1340 100 Plus
chr3R 27901430 chr3R 8856306..8856498 69..261 965 100 Plus
chr3R 27901430 chr3R 8856168..8856237 1..70 350 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:59:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:28:55
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13031331..13031601 255..525 1340 99.6 Plus
3R 32079331 3R 13031080..13031272 69..261 950 99.5 Plus
3R 32079331 3R 13030942..13031011 1..70 335 98.6 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:31:40
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 12772162..12772432 255..525 1340 99.6 Plus
3R 31820162 3R 12771911..12772103 69..261 950 99.4 Plus
3R 31820162 3R 12771773..12771842 1..70 335 98.5 Plus
Blast to na_te.dros performed on 2019-03-15 23:28:55 has no hits.

SD27354.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:29:52 Download gff for SD27354.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8856168..8856237 1..70 100 -> Plus
chr3R 8856308..8856495 71..258 100 -> Plus
chr3R 8856561..8856824 259..522 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:11:12 Download gff for SD27354.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)87Df-RA 1..333 41..373 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:39:28 Download gff for SD27354.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)87Df-RA 1..333 41..373 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:27:46 Download gff for SD27354.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)87Df-RA 1..333 41..373 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:31:15 Download gff for SD27354.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)87Df-RA 1..333 41..373 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:36:07 Download gff for SD27354.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)87Df-RA 1..333 41..373 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:12:43 Download gff for SD27354.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)87Df-RA 1..519 1..519 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:39:28 Download gff for SD27354.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)87Df-RA 1..519 1..519 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:27:46 Download gff for SD27354.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)87Df-RA 30..551 1..522 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:31:15 Download gff for SD27354.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)87Df-RA 1..519 1..519 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:36:07 Download gff for SD27354.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)87Df-RA 30..551 1..522 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:29:52 Download gff for SD27354.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13030942..13031011 1..70 98 -> Plus
3R 13031082..13031269 71..258 99 -> Plus
3R 13031335..13031598 259..522 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:29:52 Download gff for SD27354.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13030942..13031011 1..70 98 -> Plus
3R 13031082..13031269 71..258 99 -> Plus
3R 13031335..13031598 259..522 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:29:52 Download gff for SD27354.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13030942..13031011 1..70 98 -> Plus
3R 13031082..13031269 71..258 99 -> Plus
3R 13031335..13031598 259..522 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:27:46 Download gff for SD27354.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8856664..8856733 1..70 98 -> Plus
arm_3R 8856804..8856991 71..258 99 -> Plus
arm_3R 8857057..8857320 259..522 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:03:49 Download gff for SD27354.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12772166..12772429 259..522 99   Plus
3R 12771773..12771842 1..70 98 -> Plus
3R 12771913..12772100 71..258 99 -> Plus

SD27354.pep Sequence

Translation from 40 to 372

> SD27354.pep
MAEEPEEPAKSFVIFGRDVAQIPCFRNSFLYGISGGIGIGLLTFLGTSRT
HLSTHVGFGSFFCGTIAYWMTCRYQWSVRRFEQQQLREAMRRQALYEGTQ
RERDLDLKSA*

SD27354.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:03:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16929-PA 110 GF16929-PA 1..110 1..110 482 90.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:03:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19368-PA 110 GG19368-PA 1..110 1..110 507 95.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 04:03:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18369-PA 110 GH18369-PA 1..110 1..110 456 83.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:09
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)87Df-PA 110 CG7620-PA 1..110 1..110 584 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 04:03:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23358-PA 111 GI23358-PA 2..111 1..110 454 82.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:03:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24382-PA 110 GL24382-PA 1..110 1..110 493 91.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:03:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\l(3)87Df-PA 110 GA26595-PA 1..110 1..110 493 91.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:03:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24077-PA 110 GM24077-PA 1..110 1..110 575 98.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:03:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18874-PA 110 GD18874-PA 1..110 1..110 581 99.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:03:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10352-PA 110 GJ10352-PA 1..110 1..110 456 83.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:03:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12224-PA 110 GK12224-PA 1..110 1..110 478 87.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:03:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26235-PA 110 GE26235-PA 1..110 1..110 506 95.5 Plus

SD27354.hyp Sequence

Translation from 40 to 372

> SD27354.hyp
MAEEPEEPAKSFVIFGRDVAQIPCFRNSFLYGISGGIGIGLLTFLGTSRT
HLSTHVGFGSFFCGTIAYWMTCRYQWSVRRFEQQQLREAMRRQALYEGTQ
RERDLDLKSA*

SD27354.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:45:03
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)87Df-PA 110 CG7620-PA 1..110 1..110 584 100 Plus