Clone SD27505 Report

Search the DGRC for SD27505

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:275
Well:5
Vector:pOT2
Associated Gene/TranscriptCG13117-RA
Protein status:SD27505.pep: gold
Preliminary Size:621
Sequenced Size:653

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13117 2002-01-01 Sim4 clustering to Release 2
CG13117 2002-05-19 Blastp of sequenced clone
CG13117 2003-01-01 Sim4 clustering to Release 3
CG13117 2008-04-29 Release 5.5 accounting
CG13117 2008-08-15 Release 5.9 accounting
CG13117 2008-12-18 5.12 accounting

Clone Sequence Records

SD27505.complete Sequence

653 bp (653 high quality bases) assembled on 2002-05-19

GenBank Submission: AY119285

> SD27505.complete
CCGATTCATTCAGATGGCAGCCGCAGTAGTCCAAAGTTTCGGCCAGGAGG
AGCTCTTCGTCAGCCGGGCCACAATTCAGTTGCAGTTGCCCCAGGGCGGA
GCCAGTTCGCCCATCTTCGAGTGGCGCACACAGGTGGCCACGCCCACGTC
TGCCGCTGATCCCGCCCACGAGGAGAAGTGCATTAGTGGGCACCAGAGCA
CGGAAGCTGCCACGCCCAAGAGCAATATCTACACGCCCCCACGAATCCTG
GGCACGGAGGCGAAGCGCAAGAATCTGCCCCAAACGTTGAGCAATTTCTT
CGAGGCGGAGCGCTACTCCAGCGCCTGGAATCGCGTGACCAAATAGGCTG
CTCTTCCAGTCCCAATCCGAGTTCCAATCCCGAAAACCAAACGAAGGGAG
GCCTAATCGATTAACCCATTAAGTGGCAAGAGCTGCAGGATAGTGAAATT
CCATTCCGTTGCCAAAAATTCATGCCCCAAAATTGCTTACCGGATTCGGG
AGTCGGAATGGGAGGATAGAAATGGCTGCCCAGGGCTAAACCAACTATGT
ATATAAGCATCCCATGAATATTTATGTGCCACCCTCCTGTACCCTGATAA
TGCAATAAAAGTATTATTTGATAGATAAAGCGGAAAAAAAAAAAAAAAAA
AAA

SD27505.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:59:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG13117-RA 685 CG13117-RA 53..685 1..633 3165 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:10:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 9735514..9736152 1..633 2980 98.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:59:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:10:38
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9736697..9737331 1..635 3175 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:31:42
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9736697..9737331 1..635 3175 100 Plus
Blast to na_te.dros performed on 2019-03-15 23:10:38 has no hits.

SD27505.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:11:34 Download gff for SD27505.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 9735514..9736152 1..633 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:11:14 Download gff for SD27505.complete
Subject Subject Range Query Range Percent Splice Strand
CG13117-RA 1..333 14..346 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:39:32 Download gff for SD27505.complete
Subject Subject Range Query Range Percent Splice Strand
CG13117-RA 1..333 14..346 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:30:23 Download gff for SD27505.complete
Subject Subject Range Query Range Percent Splice Strand
CG13117-RA 1..333 14..346 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:31:17 Download gff for SD27505.complete
Subject Subject Range Query Range Percent Splice Strand
CG13117-RA 1..333 14..346 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:21:51 Download gff for SD27505.complete
Subject Subject Range Query Range Percent Splice Strand
CG13117-RA 1..333 14..346 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:12:47 Download gff for SD27505.complete
Subject Subject Range Query Range Percent Splice Strand
CG13117-RA 53..685 1..633 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:39:31 Download gff for SD27505.complete
Subject Subject Range Query Range Percent Splice Strand
CG13117-RA 53..685 1..633 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:30:23 Download gff for SD27505.complete
Subject Subject Range Query Range Percent Splice Strand
CG13117-RA 53..685 1..633 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:31:18 Download gff for SD27505.complete
Subject Subject Range Query Range Percent Splice Strand
CG13117-RA 53..685 1..633 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:21:51 Download gff for SD27505.complete
Subject Subject Range Query Range Percent Splice Strand
CG13117-RA 53..685 1..633 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:11:34 Download gff for SD27505.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9736697..9737329 1..633 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:11:34 Download gff for SD27505.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9736697..9737329 1..633 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:11:34 Download gff for SD27505.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9736697..9737329 1..633 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:30:23 Download gff for SD27505.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9736697..9737329 1..633 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:03:53 Download gff for SD27505.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9736697..9737329 1..633 100   Plus

SD27505.hyp Sequence

Translation from 0 to 345

> SD27505.hyp
RFIQMAAAVVQSFGQEELFVSRATIQLQLPQGGASSPIFEWRTQVATPTS
AADPAHEEKCISGHQSTEAATPKSNIYTPPRILGTEAKRKNLPQTLSNFF
EAERYSSAWNRVTK*

SD27505.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:41:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG13117-PB 110 CG13117-PB 1..110 5..114 566 100 Plus
CG13117-PA 110 CG13117-PA 1..110 5..114 566 100 Plus

SD27505.pep Sequence

Translation from 13 to 345

> SD27505.pep
MAAAVVQSFGQEELFVSRATIQLQLPQGGASSPIFEWRTQVATPTSAADP
AHEEKCISGHQSTEAATPKSNIYTPPRILGTEAKRKNLPQTLSNFFEAER
YSSAWNRVTK*

SD27505.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:05:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22796-PA 122 GF22796-PA 1..108 1..110 290 58.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:05:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10051-PA 116 GG10051-PA 1..116 1..110 453 81.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 04:05:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH25141-PA 113 GH25141-PA 1..113 1..110 181 43.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:57:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG13117-PB 110 CG13117-PB 1..110 1..110 566 100 Plus
CG13117-PA 110 CG13117-PA 1..110 1..110 566 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 04:05:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20054-PA 119 GI20054-PA 14..119 13..110 216 50.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:05:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18930-PA 129 GL18930-PA 1..126 1..110 271 57.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:05:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12058-PA 129 GA12058-PA 1..126 1..110 271 57.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:05:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17669-PA 110 GM17669-PA 1..110 1..110 563 98.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:05:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23625-PA 110 GD23625-PA 1..110 1..110 562 97.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:05:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13460-PA 107 GJ13460-PA 9..107 13..110 242 57.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:05:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24188-PA 142 GK24188-PA 1..118 1..110 271 53.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:05:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18865-PA 113 GE18865-PA 1..113 1..110 463 89.4 Plus