BDGP Sequence Production Resources |
Search the DGRC for SD27505
Library: | SD |
Tissue Source: | Drosophila melanogaster Schneider L2 cell culture |
Created by: | Ling Hong |
Date Registered: | 1999-02-25 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 275 |
Well: | 5 |
Vector: | pOT2 |
Associated Gene/Transcript | CG13117-RA |
Protein status: | SD27505.pep: gold |
Preliminary Size: | 621 |
Sequenced Size: | 653 |
Gene | Date | Evidence |
---|---|---|
CG13117 | 2002-01-01 | Sim4 clustering to Release 2 |
CG13117 | 2002-05-19 | Blastp of sequenced clone |
CG13117 | 2003-01-01 | Sim4 clustering to Release 3 |
CG13117 | 2008-04-29 | Release 5.5 accounting |
CG13117 | 2008-08-15 | Release 5.9 accounting |
CG13117 | 2008-12-18 | 5.12 accounting |
653 bp (653 high quality bases) assembled on 2002-05-19
GenBank Submission: AY119285
> SD27505.complete CCGATTCATTCAGATGGCAGCCGCAGTAGTCCAAAGTTTCGGCCAGGAGG AGCTCTTCGTCAGCCGGGCCACAATTCAGTTGCAGTTGCCCCAGGGCGGA GCCAGTTCGCCCATCTTCGAGTGGCGCACACAGGTGGCCACGCCCACGTC TGCCGCTGATCCCGCCCACGAGGAGAAGTGCATTAGTGGGCACCAGAGCA CGGAAGCTGCCACGCCCAAGAGCAATATCTACACGCCCCCACGAATCCTG GGCACGGAGGCGAAGCGCAAGAATCTGCCCCAAACGTTGAGCAATTTCTT CGAGGCGGAGCGCTACTCCAGCGCCTGGAATCGCGTGACCAAATAGGCTG CTCTTCCAGTCCCAATCCGAGTTCCAATCCCGAAAACCAAACGAAGGGAG GCCTAATCGATTAACCCATTAAGTGGCAAGAGCTGCAGGATAGTGAAATT CCATTCCGTTGCCAAAAATTCATGCCCCAAAATTGCTTACCGGATTCGGG AGTCGGAATGGGAGGATAGAAATGGCTGCCCAGGGCTAAACCAACTATGT ATATAAGCATCCCATGAATATTTATGTGCCACCCTCCTGTACCCTGATAA TGCAATAAAAGTATTATTTGATAGATAAAGCGGAAAAAAAAAAAAAAAAA AAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13117-RA | 685 | CG13117-RA | 53..685 | 1..633 | 3165 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 9735514..9736152 | 1..633 | 2980 | 98.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 9736697..9737331 | 1..635 | 3175 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 9736697..9737331 | 1..635 | 3175 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 9735514..9736152 | 1..633 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13117-RA | 1..333 | 14..346 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13117-RA | 1..333 | 14..346 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13117-RA | 1..333 | 14..346 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13117-RA | 1..333 | 14..346 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13117-RA | 1..333 | 14..346 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13117-RA | 53..685 | 1..633 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13117-RA | 53..685 | 1..633 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13117-RA | 53..685 | 1..633 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13117-RA | 53..685 | 1..633 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13117-RA | 53..685 | 1..633 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 9736697..9737329 | 1..633 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 9736697..9737329 | 1..633 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 9736697..9737329 | 1..633 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 9736697..9737329 | 1..633 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 9736697..9737329 | 1..633 | 100 | Plus |
Translation from 0 to 345
> SD27505.hyp RFIQMAAAVVQSFGQEELFVSRATIQLQLPQGGASSPIFEWRTQVATPTS AADPAHEEKCISGHQSTEAATPKSNIYTPPRILGTEAKRKNLPQTLSNFF EAERYSSAWNRVTK*
Translation from 13 to 345
> SD27505.pep MAAAVVQSFGQEELFVSRATIQLQLPQGGASSPIFEWRTQVATPTSAADP AHEEKCISGHQSTEAATPKSNIYTPPRILGTEAKRKNLPQTLSNFFEAER YSSAWNRVTK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF22796-PA | 122 | GF22796-PA | 1..108 | 1..110 | 290 | 58.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG10051-PA | 116 | GG10051-PA | 1..116 | 1..110 | 453 | 81.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH25141-PA | 113 | GH25141-PA | 1..113 | 1..110 | 181 | 43.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13117-PB | 110 | CG13117-PB | 1..110 | 1..110 | 566 | 100 | Plus |
CG13117-PA | 110 | CG13117-PA | 1..110 | 1..110 | 566 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20054-PA | 119 | GI20054-PA | 14..119 | 13..110 | 216 | 50.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL18930-PA | 129 | GL18930-PA | 1..126 | 1..110 | 271 | 57.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12058-PA | 129 | GA12058-PA | 1..126 | 1..110 | 271 | 57.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM17669-PA | 110 | GM17669-PA | 1..110 | 1..110 | 563 | 98.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23625-PA | 110 | GD23625-PA | 1..110 | 1..110 | 562 | 97.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13460-PA | 107 | GJ13460-PA | 9..107 | 13..110 | 242 | 57.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK24188-PA | 142 | GK24188-PA | 1..118 | 1..110 | 271 | 53.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE18865-PA | 113 | GE18865-PA | 1..113 | 1..110 | 463 | 89.4 | Plus |