Clone SD28012 Report

Search the DGRC for SD28012

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:280
Well:12
Vector:pOT2
Associated Gene/Transcriptash2-RB
Protein status:SD28012.pep: gold
Preliminary Size:2075
Sequenced Size:1322

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6677 2004-01-13 Blastp of sequenced clone
ash2 2008-04-29 Release 5.5 accounting
ash2 2008-08-15 Release 5.9 accounting
ash2 2008-12-18 5.12 accounting

Clone Sequence Records

SD28012.complete Sequence

1322 bp (1322 high quality bases) assembled on 2004-01-13

GenBank Submission: BT011328

> SD28012.complete
CAATTGCAAGGCCCCCGCTCCTTCAGTTCCATTGTGACCGGGTCCTGCTT
CTGCTCCTGCTCATTCTCCCTCCGCGATGGCGTCATCTTTTACGGACGAG
GAGTCTTCCCTCTCCAAAAACAATCGACAGAAAAGGAAATTTCCCGGCAC
GGATTCGGGTCCCACGGGCAAGAAGGGTCGGCCCAGTTCCGATATTACGG
CCAATGTAAAGTTGCCACCGCATGGCTATCCATTGGAACACCCCTTCAAC
AAGGATGGCTATCGTTATATACTCGCCGAACCGGATCCACATGCTCCATT
TCGTCAGGAGTTCGACGAGAGCTCCGATTGGGCTGGCAAACCTATCCCCG
GCTGGCTCTACCGCATCCTGGTGCCACATTCTGTGCTCCTGGCGCTGCAT
GATCGGGCACCACAGCTGAAAATAAGCGAGGATCGGTTGGCGGTGACGGG
CGAACGTGGTTACTGCATGGTCCGAGCCACACACTCTGTGAACCGGGGAT
GCTGGTACTTTGAGGTCACCATCGAAGAGATGCCCGACGGAGCTGCCACG
CGACTTGGCTGGGGCCGGGAGTACGGCAACTTGCAGGCTCCATTGGGATA
CGACAAGTTCGGTTACTCCTGGAGATCTCGCAAGGGCACCAAGTTTACCG
AGAGCCATGGCAAACACTACAGTGATGCCTATGTGGAGGGCGATACATTG
GGATTCCTCATAGAGCTGCCAGAGGAGGCGTCGCTCGACTATCTGCCCAA
CACATTCAAAGATCGGCCCCTGGTCAAGTTCAAGTCTCATCTGTACTACG
AGGATAAGGACAAGATCACAGAAACCCTGAAAAATCTGCACATCCTGCAG
GGCAGCCGCATCGAGTTCTTTAAGAACGGTCAATCGCAGGGTGTGGCATT
CGAAGACATTTATGCCGGCAGCTATTTCCCGGCCATCTCGATCCACAAAA
GTGCAACGGTCAGCGTAAACTTCGGACCCGCCTTCAAGTATCCCGAGGTG
CTCGTCGAGCACAAAGCCAAGGGGATGCACGATCGCGTGGAGGAGCTGAT
CACAGAGCAATGTTTAGCCGACACCCTCTACCTCACAGAACACGATGGAC
GTCTGCGCTTGGATAATATGGGTCTTTAGTGGGATATGTCGTCATACACA
TGAGTTTTGGAGAACTAGTGTGTTATTTTTGTATGCACTATACTTTGGAA
AGCAGAAATTTGAAAAGACTATCATCATACTATCATACCTAAAACATTTA
AAATTTACCACTTTTAAAGCAGAAGAATTTTAAGAAAACACTCTTTTGAG
ATCAAAAAAAAAAAAAAAAAAA

SD28012.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:09:19
Subject Length Description Subject Range Query Range Score Percent Strand
ash2-RB 1459 ash2-RB 157..1459 1..1303 6515 100 Plus
ash2-RC 2020 ash2-RC 821..2020 105..1304 6000 100 Plus
ash2-RD 1971 ash2-RD 772..1971 105..1304 6000 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:58:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 20475109..20475489 105..485 1905 100 Plus
chr3R 27901430 chr3R 20475558..20475838 486..766 1405 100 Plus
chr3R 27901430 chr3R 20476345..20476624 1024..1303 1400 100 Plus
chr3R 27901430 chr3R 20476029..20476287 766..1024 1295 100 Plus
chr3R 27901430 chr3R 20474775..20474878 1..104 520 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:59:12 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:58:23
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24651861..24652241 105..485 1905 100 Plus
3R 32079331 3R 24652310..24652590 486..766 1405 100 Plus
3R 32079331 3R 24653097..24653377 1024..1304 1405 100 Plus
3R 32079331 3R 24652781..24653039 766..1024 1295 100 Plus
3R 32079331 3R 24651527..24651630 1..104 520 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:53:44
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 24392692..24393072 105..485 1905 100 Plus
3R 31820162 3R 24393928..24394208 1024..1304 1405 100 Plus
3R 31820162 3R 24393141..24393421 486..766 1405 100 Plus
3R 31820162 3R 24393612..24393870 766..1024 1295 100 Plus
3R 31820162 3R 24392358..24392461 1..104 520 100 Plus
Blast to na_te.dros performed on 2019-03-15 16:58:23 has no hits.

SD28012.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:59:13 Download gff for SD28012.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 20474775..20474878 1..104 100 -> Plus
chr3R 20476030..20476287 767..1024 100 -> Plus
chr3R 20475558..20475838 486..766 100 -> Plus
chr3R 20475109..20475489 105..485 100 -> Plus
chr3R 20476346..20476624 1025..1303 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:11:25 Download gff for SD28012.complete
Subject Subject Range Query Range Percent Splice Strand
ash2-RB 1..1053 77..1129 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:42:22 Download gff for SD28012.complete
Subject Subject Range Query Range Percent Splice Strand
ash2-RB 1..1053 77..1129 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:13:42 Download gff for SD28012.complete
Subject Subject Range Query Range Percent Splice Strand
ash2-RB 1..1053 77..1129 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:31:12 Download gff for SD28012.complete
Subject Subject Range Query Range Percent Splice Strand
ash2-RB 1..1053 77..1129 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:22:13 Download gff for SD28012.complete
Subject Subject Range Query Range Percent Splice Strand
ash2-RB 1..1053 77..1129 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:52:04 Download gff for SD28012.complete
Subject Subject Range Query Range Percent Splice Strand
ash2-RB 1..1303 1..1303 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:42:22 Download gff for SD28012.complete
Subject Subject Range Query Range Percent Splice Strand
ash2-RB 1..1303 1..1303 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:13:42 Download gff for SD28012.complete
Subject Subject Range Query Range Percent Splice Strand
ash2-RB 111..1413 1..1303 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:31:12 Download gff for SD28012.complete
Subject Subject Range Query Range Percent Splice Strand
ash2-RB 1..1303 1..1303 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:22:13 Download gff for SD28012.complete
Subject Subject Range Query Range Percent Splice Strand
ash2-RB 111..1413 1..1303 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:59:13 Download gff for SD28012.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24651527..24651630 1..104 100 -> Plus
3R 24651861..24652241 105..485 100 -> Plus
3R 24652310..24652590 486..766 100 -> Plus
3R 24652782..24653039 767..1024 100 -> Plus
3R 24653098..24653376 1025..1303 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:59:13 Download gff for SD28012.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24651527..24651630 1..104 100 -> Plus
3R 24651861..24652241 105..485 100 -> Plus
3R 24652310..24652590 486..766 100 -> Plus
3R 24652782..24653039 767..1024 100 -> Plus
3R 24653098..24653376 1025..1303 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:59:13 Download gff for SD28012.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24651527..24651630 1..104 100 -> Plus
3R 24651861..24652241 105..485 100 -> Plus
3R 24652310..24652590 486..766 100 -> Plus
3R 24652782..24653039 767..1024 100 -> Plus
3R 24653098..24653376 1025..1303 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:13:42 Download gff for SD28012.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20478032..20478312 486..766 100 -> Plus
arm_3R 20478504..20478761 767..1024 100 -> Plus
arm_3R 20478820..20479098 1025..1303 100   Plus
arm_3R 20477249..20477352 1..104 100 -> Plus
arm_3R 20477583..20477963 105..485 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:03:44 Download gff for SD28012.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24392692..24393072 105..485 100 -> Plus
3R 24393141..24393421 486..766 100 -> Plus
3R 24393613..24393870 767..1024 100 -> Plus
3R 24393929..24394207 1025..1303 100   Plus
3R 24392358..24392461 1..104 100 -> Plus

SD28012.pep Sequence

Translation from 76 to 1128

> SD28012.pep
MASSFTDEESSLSKNNRQKRKFPGTDSGPTGKKGRPSSDITANVKLPPHG
YPLEHPFNKDGYRYILAEPDPHAPFRQEFDESSDWAGKPIPGWLYRILVP
HSVLLALHDRAPQLKISEDRLAVTGERGYCMVRATHSVNRGCWYFEVTIE
EMPDGAATRLGWGREYGNLQAPLGYDKFGYSWRSRKGTKFTESHGKHYSD
AYVEGDTLGFLIELPEEASLDYLPNTFKDRPLVKFKSHLYYEDKDKITET
LKNLHILQGSRIEFFKNGQSQGVAFEDIYAGSYFPAISIHKSATVSVNFG
PAFKYPEVLVEHKAKGMHDRVEELITEQCLADTLYLTEHDGRLRLDNMGL
*

SD28012.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:25:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17218-PA 555 GF17218-PA 205..555 2..350 1783 93.2 Plus
Dana\GF20784-PA 483 GF20784-PA 124..459 1..338 1211 67.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:25:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11306-PA 556 GG11306-PA 215..556 9..350 1836 97.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:25:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18438-PA 576 GH18438-PA 235..576 9..350 1699 89.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:51:37
Subject Length Description Subject Range Query Range Score Percent Strand
ash2-PB 350 CG6677-PB 1..350 1..350 1886 100 Plus
ash2-PC 556 CG6677-PC 215..556 9..350 1841 99.4 Plus
ash2-PE 220 CG6677-PE 1..220 131..350 1179 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:25:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24014-PA 554 GI24014-PA 213..554 9..350 1721 91.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:25:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13614-PA 557 GL13614-PA 216..557 9..350 1776 94.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:25:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26848-PA 557 GA26848-PA 216..557 9..350 1772 93.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:25:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26615-PA 556 GM26615-PA 215..556 9..350 1840 98.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:25:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21115-PA 350 GD21115-PA 1..350 1..350 1870 99.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:25:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23645-PA 573 GJ23645-PA 232..573 9..350 1733 91.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:25:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10965-PA 569 GK10965-PA 227..559 9..341 1720 93.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:25:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23503-PA 626 GE23503-PA 285..626 9..350 1833 97.4 Plus

SD28012.hyp Sequence

Translation from 76 to 1128

> SD28012.hyp
MASSFTDEESSLSKNNRQKRKFPGTDSGPTGKKGRPSSDITANVKLPPHG
YPLEHPFNKDGYRYILAEPDPHAPFRQEFDESSDWAGKPIPGWLYRILVP
HSVLLALHDRAPQLKISEDRLAVTGERGYCMVRATHSVNRGCWYFEVTIE
EMPDGAATRLGWGREYGNLQAPLGYDKFGYSWRSRKGTKFTESHGKHYSD
AYVEGDTLGFLIELPEEASLDYLPNTFKDRPLVKFKSHLYYEDKDKITET
LKNLHILQGSRIEFFKNGQSQGVAFEDIYAGSYFPAISIHKSATVSVNFG
PAFKYPEVLVEHKAKGMHDRVEELITEQCLADTLYLTEHDGRLRLDNMGL
*

SD28012.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:28:33
Subject Length Description Subject Range Query Range Score Percent Strand
ash2-PB 350 CG6677-PB 1..350 1..350 1886 100 Plus
ash2-PC 556 CG6677-PC 215..556 9..350 1841 99.4 Plus
ash2-PE 220 CG6677-PE 1..220 131..350 1179 100 Plus