TA01006.complete Sequence
535 bp assembled on 2009-08-13
GenBank Submission: BT099590.1
> TA01006.complete
ATTCGTGCCAACGCGCTCAACTGCGACGGTCCGCTGAACAAAACGGTGTG
CGGATTTGCTTTGCACACTGGACAAAGGAAATGTCCCATTTGTCGGCTTA
TCCAGCATATACGTCAGTCTAAACATGGAGAAAAGCTGCAGTATTGGCAA
CGGACGGGAGCAATACGGCTGGGGACATGGCGAACAATGCGGCACGCAGT
TCCTTGAATGTGTCTACAGGAACGCGTCCATGTACTCTGTTCTGGGCGAT
CTGATCACATACGTGGTGTTCCTGGGGGCTACGTGCTACGCAATACTTTT
CGGCTTCCGACTGTTGCTGTCCTGCGTGCGAATCGTCCTCAAAGTGGTTA
TCGCCCTCTTCGTCATCCGATTGCTGCTAGCTTTGGGCTCCGTCGACATC
ACATCTGTTAGCTATTCCGGGTGAAGTGACCAATCTGGCGAATGCCATCG
GGACCACGGCCTTTTAAACTACATTAACTAAATCAAATATAAATTCCAAA
TTGAGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
TA01006.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 16:30:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18343-RA | 475 | CG18343-RA | 1..435 | 69..504 | 2140 | 99.7 | Plus |
Exn-RB | 3598 | Exn-RB | 21..74 | 1..54 | 270 | 100 | Plus |
Exn-RA | 3881 | Exn-RA | 21..74 | 1..54 | 270 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:25:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 8025989..8026439 | 53..504 | 2195 | 99.6 | Plus |
chr3L | 24539361 | chr3L | 16976063..16976116 | 1..54 | 255 | 98.1 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:59:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:25:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 12138786..12139236 | 53..504 | 2210 | 99.8 | Plus |
3L | 28110227 | 3L | 16986636..16986689 | 1..54 | 270 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:26:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 12139985..12140435 | 53..504 | 2220 | 99.7 | Plus |
3L | 28103327 | 3L | 16979736..16979789 | 1..54 | 270 | 100 | Plus |
Blast to na_te.dros performed 2019-03-16 17:25:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
diver | 6112 | diver Tinker 6112bp | 2607..2674 | 286..223 | 105 | 66.2 | Minus |
TA01006.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:26:37 Download gff for
TA01006.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 8025984..8026439 | 47..505 | 98 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:14:10 Download gff for
TA01006.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18343-RA | 1..300 | 125..424 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:58:51 Download gff for
TA01006.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18343-RA | 1..300 | 125..424 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:33:35 Download gff for
TA01006.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18343-RA | 1..300 | 125..424 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:58:47 Download gff for
TA01006.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18343-RA | 1..300 | 125..424 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-08-13 17:45:37 Download gff for
TA01006.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18343-RA | 1..435 | 69..505 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:58:50 Download gff for
TA01006.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18343-RA | 1..435 | 69..505 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:33:35 Download gff for
TA01006.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18343-RB | 87..542 | 47..505 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:58:47 Download gff for
TA01006.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18343-RB | 87..542 | 47..505 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:26:37 Download gff for
TA01006.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 12138781..12139236 | 47..505 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:26:37 Download gff for
TA01006.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 12138781..12139236 | 47..505 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:26:37 Download gff for
TA01006.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 12138781..12139236 | 47..505 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:33:35 Download gff for
TA01006.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 8026286..8026741 | 47..505 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:50:33 Download gff for
TA01006.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 12139980..12140435 | 47..505 | 98 | | Plus |
TA01006.hyp Sequence
Translation from 49 to 423
> TA01006.hyp
EDLLCTLDKGNVPFVGLSSIYVSLNMEKSCSIGNGREQYGWGHGEQCGTQ
FLECVYRNASMYSVLGDLITYVVFLGATCYAILFGFRLLLSCVRIVLKVV
IALFVIRLLLALGSVDITSVSYSG*
TA01006.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:23:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18343-PB | 99 | CG18343-PB | 1..99 | 26..124 | 510 | 100 | Plus |
CG18343-PA | 99 | CG18343-PA | 1..99 | 26..124 | 510 | 100 | Plus |
TA01006.pep Sequence
Translation from 124 to 423
> TA01006.pep
MEKSCSIGNGREQYGWGHGEQCGTQFLECVYRNASMYSVLGDLITYVVFL
GATCYAILFGFRLLLSCVRIVLKVVIALFVIRLLLALGSVDITSVSYSG*
TA01006.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:28:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG20246-PA | 89 | GG20246-PA | 1..85 | 1..85 | 173 | 48.2 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:18:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18343-PB | 99 | CG18343-PB | 1..99 | 1..99 | 510 | 100 | Plus |
CG18343-PA | 99 | CG18343-PA | 1..99 | 1..99 | 510 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:28:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM21332-PA | 99 | GM21332-PA | 1..98 | 1..98 | 329 | 74.5 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:28:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD10840-PA | 99 | GD10840-PA | 1..98 | 1..98 | 372 | 73.5 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:28:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE12405-PA | 110 | GE12405-PA | 1..98 | 1..95 | 220 | 50 | Plus |