Clone TA01006 Report

Search the DGRC for TA01006

Clone and Library Details

Library:TA
Tissue Source:D melanogaster total adult RNA
Created by: 
Date Registered:2007-04-30
Comments: 
Original Plate Number:10
Well:6
Vector:pOTB7_DraIII
Associated Gene/TranscriptCG18343-RA
Protein status:TA01006.pep: gold
Sequenced Size:535

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18343 2009-06-08 Manual selection by Joe Carlson

Clone Sequence Records

TA01006.complete Sequence

535 bp assembled on 2009-08-13

GenBank Submission: BT099590.1

> TA01006.complete
ATTCGTGCCAACGCGCTCAACTGCGACGGTCCGCTGAACAAAACGGTGTG
CGGATTTGCTTTGCACACTGGACAAAGGAAATGTCCCATTTGTCGGCTTA
TCCAGCATATACGTCAGTCTAAACATGGAGAAAAGCTGCAGTATTGGCAA
CGGACGGGAGCAATACGGCTGGGGACATGGCGAACAATGCGGCACGCAGT
TCCTTGAATGTGTCTACAGGAACGCGTCCATGTACTCTGTTCTGGGCGAT
CTGATCACATACGTGGTGTTCCTGGGGGCTACGTGCTACGCAATACTTTT
CGGCTTCCGACTGTTGCTGTCCTGCGTGCGAATCGTCCTCAAAGTGGTTA
TCGCCCTCTTCGTCATCCGATTGCTGCTAGCTTTGGGCTCCGTCGACATC
ACATCTGTTAGCTATTCCGGGTGAAGTGACCAATCTGGCGAATGCCATCG
GGACCACGGCCTTTTAAACTACATTAACTAAATCAAATATAAATTCCAAA
TTGAGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

TA01006.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:30:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG18343-RA 475 CG18343-RA 1..435 69..504 2140 99.7 Plus
Exn-RB 3598 Exn-RB 21..74 1..54 270 100 Plus
Exn-RA 3881 Exn-RA 21..74 1..54 270 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:25:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8025989..8026439 53..504 2195 99.6 Plus
chr3L 24539361 chr3L 16976063..16976116 1..54 255 98.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:59:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:25:41
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12138786..12139236 53..504 2210 99.8 Plus
3L 28110227 3L 16986636..16986689 1..54 270 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:26:43
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12139985..12140435 53..504 2220 99.7 Plus
3L 28103327 3L 16979736..16979789 1..54 270 100 Plus
Blast to na_te.dros performed 2019-03-16 17:25:41
Subject Length Description Subject Range Query Range Score Percent Strand
diver 6112 diver Tinker 6112bp 2607..2674 286..223 105 66.2 Minus

TA01006.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:26:37 Download gff for TA01006.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8025984..8026439 47..505 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:14:10 Download gff for TA01006.complete
Subject Subject Range Query Range Percent Splice Strand
CG18343-RA 1..300 125..424 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:58:51 Download gff for TA01006.complete
Subject Subject Range Query Range Percent Splice Strand
CG18343-RA 1..300 125..424 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:33:35 Download gff for TA01006.complete
Subject Subject Range Query Range Percent Splice Strand
CG18343-RA 1..300 125..424 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:58:47 Download gff for TA01006.complete
Subject Subject Range Query Range Percent Splice Strand
CG18343-RA 1..300 125..424 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-08-13 17:45:37 Download gff for TA01006.complete
Subject Subject Range Query Range Percent Splice Strand
CG18343-RA 1..435 69..505 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:58:50 Download gff for TA01006.complete
Subject Subject Range Query Range Percent Splice Strand
CG18343-RA 1..435 69..505 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:33:35 Download gff for TA01006.complete
Subject Subject Range Query Range Percent Splice Strand
CG18343-RB 87..542 47..505 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:58:47 Download gff for TA01006.complete
Subject Subject Range Query Range Percent Splice Strand
CG18343-RB 87..542 47..505 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:26:37 Download gff for TA01006.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12138781..12139236 47..505 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:26:37 Download gff for TA01006.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12138781..12139236 47..505 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:26:37 Download gff for TA01006.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12138781..12139236 47..505 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:33:35 Download gff for TA01006.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8026286..8026741 47..505 98   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:50:33 Download gff for TA01006.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12139980..12140435 47..505 98   Plus

TA01006.hyp Sequence

Translation from 49 to 423

> TA01006.hyp
EDLLCTLDKGNVPFVGLSSIYVSLNMEKSCSIGNGREQYGWGHGEQCGTQ
FLECVYRNASMYSVLGDLITYVVFLGATCYAILFGFRLLLSCVRIVLKVV
IALFVIRLLLALGSVDITSVSYSG*

TA01006.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:23:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG18343-PB 99 CG18343-PB 1..99 26..124 510 100 Plus
CG18343-PA 99 CG18343-PA 1..99 26..124 510 100 Plus

TA01006.pep Sequence

Translation from 124 to 423

> TA01006.pep
MEKSCSIGNGREQYGWGHGEQCGTQFLECVYRNASMYSVLGDLITYVVFL
GATCYAILFGFRLLLSCVRIVLKVVIALFVIRLLLALGSVDITSVSYSG*

TA01006.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:28:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20246-PA 89 GG20246-PA 1..85 1..85 173 48.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:18:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG18343-PB 99 CG18343-PB 1..99 1..99 510 100 Plus
CG18343-PA 99 CG18343-PA 1..99 1..99 510 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:28:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21332-PA 99 GM21332-PA 1..98 1..98 329 74.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:28:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10840-PA 99 GD10840-PA 1..98 1..98 372 73.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:28:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12405-PA 110 GE12405-PA 1..98 1..95 220 50 Plus