Clone TA01180 Report

Search the DGRC for TA01180

Clone and Library Details

Library:TA
Tissue Source:D melanogaster total adult RNA
Created by: 
Date Registered:2007-04-30
Comments: 
Original Plate Number:11
Well:80
Vector:pOTB7_DraIII
Associated Gene/TranscriptCG14645-RA
Protein status:TA01180.pep: gold
Sequenced Size:439

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14645 2008-04-29 Release 5.5 accounting
CG14645 2008-08-15 Release 5.9 accounting
CG14645 2008-12-18 5.12 accounting

Clone Sequence Records

TA01180.complete Sequence

439 bp assembled on 2007-08-08

GenBank Submission: BT031033

> TA01180.complete
ATAGAACATTTTTTGAAAGATGAAGGTTCAGCTCGCTCTAACCTCCCTAC
TAGTGATTTCTTTTGGCATTGCCCTCGCCTATGATGGTGACGGACAGCCG
GGTTGCAAGACCCAAGCCGAGCTAGACATTGTAGTTTTCCGCAACAATTG
GGATGCCACATCGTATTGGAAGTGTGAGACACTTAACAAACCAGCCATTG
AAATCAAGTGCCCCAGCGAAACAGGATTCATGGATAGTCTCAAGAACTGC
GTCAACTGGGAGGAATGGGAATGGGAGAAACCAGTGGAGCCCCTTAGCGA
AGCGGATCAGTGACCAAACGCACAAAAATAAGAACAGCTAAATGTGATTA
TTTATGTTGTTGAATTGAGAATAAAATAACTGCGTTACGGGTGGCTTACG
CAGCAAAACAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

TA01180.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:02:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG14645-RA 418 CG14645-RA 1..412 1..412 2060 100 Plus
CG9772-RA 2075 CG9772-RA 1849..2075 412..186 1135 100 Minus
CG9772-RC 2136 CG9772-RC 1910..2136 412..186 1135 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:12:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 160818..161226 1..409 2045 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:59:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:12:26
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 4335098..4335509 1..412 2060 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:58:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 4075929..4076340 1..412 2060 100 Plus
Blast to na_te.dros performed on 2019-03-16 11:12:26 has no hits.

TA01180.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:13:32 Download gff for TA01180.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 160818..161226 1..409 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:11:31 Download gff for TA01180.complete
Subject Subject Range Query Range Percent Splice Strand
CG14645-RA 1..294 20..313 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:00:33 Download gff for TA01180.complete
Subject Subject Range Query Range Percent Splice Strand
CG14645-RA 1..294 20..313 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:08:32 Download gff for TA01180.complete
Subject Subject Range Query Range Percent Splice Strand
CG14645-RA 1..294 20..313 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:59:59 Download gff for TA01180.complete
Subject Subject Range Query Range Percent Splice Strand
CG14645-RA 1..294 20..313 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:29:35 Download gff for TA01180.complete
Subject Subject Range Query Range Percent Splice Strand
CG14645-RA 1..294 20..313 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:25:42 Download gff for TA01180.complete
Subject Subject Range Query Range Percent Splice Strand
CG14645-RA 1..390 20..409 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:00:33 Download gff for TA01180.complete
Subject Subject Range Query Range Percent Splice Strand
CG14645-RA 1..390 20..409 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:08:32 Download gff for TA01180.complete
Subject Subject Range Query Range Percent Splice Strand
Skp2-RA 1797..2205 1..409 100   Minus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:00:00 Download gff for TA01180.complete
Subject Subject Range Query Range Percent Splice Strand
CG14645-RA 1..390 20..409 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:29:35 Download gff for TA01180.complete
Subject Subject Range Query Range Percent Splice Strand
Skp2-RA 1785..2193 1..409 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:13:32 Download gff for TA01180.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4335098..4335506 1..409 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:13:32 Download gff for TA01180.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4335098..4335506 1..409 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:13:32 Download gff for TA01180.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4335098..4335506 1..409 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:08:32 Download gff for TA01180.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 160820..161228 1..409 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:35:52 Download gff for TA01180.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4075929..4076337 1..409 100   Plus

TA01180.hyp Sequence

Translation from 19 to 312

> TA01180.hyp
MKVQLALTSLLVISFGIALAYDGDGQPGCKTQAELDIVVFRNNWDATSYW
KCETLNKPAIEIKCPSETGFMDSLKNCVNWEEWEWEKPVEPLSEADQ*

TA01180.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:26:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG14645-PA 97 CG14645-PA 1..97 1..97 531 100 Plus
CG14245-PB 103 CG14245-PB 29..100 25..96 172 38.9 Plus
CG14245-PA 103 CG14245-PA 29..100 25..96 172 38.9 Plus
Peritrophin-15a-PA 92 CG17814-PA 16..88 12..85 161 39.2 Plus
CG14300-PA 94 CG14300-PA 1..90 1..91 161 34.1 Plus

TA01180.pep Sequence

Translation from 19 to 312

> TA01180.pep
MKVQLALTSLLVISFGIALAYDGDGQPGCKTQAELDIVVFRNNWDATSYW
KCETLNKPAIEIKCPSETGFMDSLKNCVNWEEWEWEKPVEPLSEADQ*

TA01180.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 06:44:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18205-PA 97 GF18205-PA 1..97 1..97 404 75.3 Plus
Dana\GF16020-PA 95 GF16020-PA 1..95 1..97 374 71.1 Plus
Dana\GF17869-PA 94 GF17869-PA 1..90 1..91 180 37.4 Plus
Dana\GF16454-PA 79 GF16454-PA 5..76 22..94 158 39.7 Plus
Dana\GF16453-PA 104 GF16453-PA 14..98 9..94 151 36 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:44:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12307-PA 99 GG12307-PA 1..97 1..97 465 88.7 Plus
Dere\GG16351-PA 94 GG16351-PA 1..90 1..91 166 36.3 Plus
Dere\GG11498-PA 103 GG11498-PA 21..100 16..96 163 38.3 Plus
Dere\GG11500-PA 86 GG11500-PA 5..83 22..94 144 33.8 Plus
Dere\GG12118-PA 98 GG12118-PA 16..89 21..95 137 33.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 06:44:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18866-PA 98 GH18866-PA 1..96 1..96 320 55.2 Plus
Dgri\GH22109-PA 92 GH22109-PA 23..88 25..91 144 37.3 Plus
Dgri\GH23828-PA 88 GH23828-PA 14..86 21..94 144 37.8 Plus
Dgri\GH14236-PA 107 GH14236-PA 1..99 1..94 129 34 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:13:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG14645-PA 97 CG14645-PA 1..97 1..97 531 100 Plus
CG14245-PB 103 CG14245-PB 29..100 25..96 172 38.9 Plus
CG14245-PA 103 CG14245-PA 29..100 25..96 172 38.9 Plus
Peritrophin-15a-PA 92 CG17814-PA 16..88 12..85 161 39.2 Plus
CG14300-PA 94 CG14300-PA 1..90 1..91 161 34.1 Plus
CG14244-PB 106 CG14244-PB 16..98 10..93 148 40.5 Plus
CG34282-PB 94 CG34282-PB 3..91 2..88 144 35.6 Plus
CG34282-PA 94 CG34282-PA 3..91 2..88 144 35.6 Plus
CG14246-PC 93 CG14246-PC 5..87 22..91 143 32.1 Plus
CG14246-PB 93 CG14246-PB 5..87 22..91 143 32.1 Plus
CG14246-PA 93 CG14246-PA 5..87 22..91 143 32.1 Plus
CG3348-PB 98 CG3348-PB 16..89 21..95 143 33.3 Plus
CG3348-PA 98 CG3348-PA 16..89 21..95 143 33.3 Plus
Peritrophin-15b-PB 91 CG31893-PB 4..90 3..93 134 30.8 Plus
Peritrophin-15b-PC 93 CG31893-PC 6..92 3..93 134 30.8 Plus
Peritrophin-15b-PA 93 CG31893-PA 6..92 3..93 134 30.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 06:45:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24723-PA 97 GI24723-PA 1..97 1..97 349 60.8 Plus
Dmoj\GI24570-PA 89 GI24570-PA 14..86 21..94 154 37.8 Plus
Dmoj\GI22144-PA 99 GI22144-PA 1..96 7..94 147 32.3 Plus
Dmoj\GI21959-PA 92 GI21959-PA 19..92 22..95 135 36 Plus
Dmoj\GI22143-PA 104 GI22143-PA 7..96 10..94 130 37.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 06:45:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12319-PA 97 GL12319-PA 1..97 1..97 359 64.9 Plus
Dper\GL27220-PA 80 GL27220-PA 5..78 22..95 162 40 Plus
Dper\GL27219-PA 104 GL27219-PA 18..104 13..95 161 34.5 Plus
Dper\GL23111-PA 95 GL23111-PA 26..95 25..95 151 39.4 Plus
Dper\GL23592-PA 102 GL23592-PA 18..90 21..94 136 33.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 06:45:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13143-PA 97 GA13143-PA 1..97 1..97 359 64.9 Plus
Dpse\GA26776-PA 104 GA26776-PA 18..104 13..95 158 34.5 Plus
Dpse\GA17212-PA 80 GA17212-PA 5..77 22..94 156 39.2 Plus
Dpse\GA27144-PA 95 GA27144-PA 3..91 2..91 155 33.3 Plus
Dpse\GA17395-PA 102 GA17395-PA 18..90 21..94 136 33.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 06:45:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10746-PA 97 GM10746-PA 1..97 1..97 495 96.9 Plus
Dsec\GM10341-PA 103 GM10341-PA 21..100 16..96 163 37 Plus
Dsec\GM18688-PA 94 GM18688-PA 1..90 1..91 159 34.1 Plus
Dsec\GM10342-PA 89 GM10342-PA 5..86 22..94 140 33.7 Plus
Dsec\GM10110-PA 98 GM10110-PA 16..89 21..95 137 33.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 06:45:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19718-PA 97 GD19718-PA 1..97 1..97 489 94.8 Plus
Dsim\GD21301-PA 103 GD21301-PA 21..100 16..96 163 37 Plus
Dsim\GD20155-PA 94 GD20155-PA 1..90 1..91 159 34.1 Plus
Dsim\GD22405-PA 92 GD22405-PA 1..88 1..85 143 39.3 Plus
Dsim\GD21302-PA 91 GD21302-PA 5..85 22..91 140 34.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 06:45:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14550-PA 97 GJ14550-PA 1..97 1..97 367 64.9 Plus
Dvir\GJ24263-PA 102 GJ24263-PA 12..96 9..94 154 34.9 Plus
Dvir\GJ18192-PA 90 GJ18192-PA 6..86 3..88 151 34.9 Plus
Dvir\GJ14319-PA 92 GJ14319-PA 23..92 25..95 149 38 Plus
Dvir\GJ22636-PA 89 GJ22636-PA 14..86 21..94 142 35.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 06:45:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11657-PA 99 GK11657-PA 1..97 1..96 339 63.9 Plus
Dwil\GK13541-PA 106 GK13541-PA 31..102 25..96 154 38.9 Plus
Dwil\GK18958-PA 84 GK18958-PA 9..84 22..97 153 35.1 Plus
Dwil\GK13552-PA 92 GK13552-PA 1..92 1..95 138 31.2 Plus
Dwil\GK11341-PA 97 GK11341-PA 18..95 21..95 132 32.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:45:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25408-PA 97 GE25408-PA 1..97 1..97 496 95.9 Plus
Dyak\GE25180-PA 94 GE25180-PA 1..94 1..95 175 38.5 Plus
Dyak\GE25179-PA 94 GE25179-PA 1..94 1..95 175 38.5 Plus
Dyak\GE23689-PA 103 GE23689-PA 21..100 16..96 158 34.6 Plus
Dyak\GE23690-PA 89 GE23690-PA 5..86 22..94 156 34.9 Plus