Clone TA01342 Report

Search the DGRC for TA01342

Clone and Library Details

Library:TA
Tissue Source:D melanogaster total adult RNA
Created by: 
Date Registered:2007-04-30
Comments: 
Original Plate Number:13
Well:42
Vector:pOTB7_DraIII
Associated Gene/TranscriptCG18853-RA
Protein status:TA01342.pep: gold
Sequenced Size:1162

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18853 2008-04-29 Release 5.5 accounting
CG18853 2008-04-29 Picked prior to 5.5
CG18853 2008-08-15 Release 5.9 accounting
CG18853 2008-12-18 5.12 accounting

Clone Sequence Records

TA01342.complete Sequence

1162 bp assembled on 2007-11-15

GenBank Submission: BT031305

> TA01342.complete
AGCTGGATGTAACCATTGAGAATCGAGGTAAATATTGGTCAATAACAGCG
GAGAACGCTGCAATTGCGGATTATTTGGGAGTCAAGTGCGCGTTGCCGGC
AGCGAAAATGCACGAGGATGATCTGAAGAGTCAGTTGACCATCGCGCGGA
ACGAGATCAACAATCTCAGGCAGCAAGTGCGCAACCTGCAGCATGTGCAG
CGCAAGGACATTGAGACGATAACCCGCCTGCTGCAGGACTTCCGCTGCGA
GGGGTGTGCGAACAACAACAAAAGCGCCAAGGACAAGGTCGCCGGCGAGA
AGCAGGAGCACCAGCACCAACAGCAGACGCAGGACCAGCAGACGGGCCAA
GGTCAGAGCAATTATACCAATGGTGGGCACTGCTTGGGAGAGGACTACGC
ACACTTTCGGCCCATAGGAGTGATCCGGACAGCATTCCCAGAGAAGCGGG
CCGTGCCGAGGCAGTCAATTGTGGGCAGTCGCCTGCGGGGTATCATCCAA
CTGAACGACGGTGTGTTCACCAATCCGGAGCACTCCTTGGAGGGACTAGA
GGACTTTTCCCATCTGTGGCTCATCTATCATTTTCACCGCAACAATTCCC
ACCCCAAGGCCAAGGCGGATAACTTTTGCTTCTACAACGAGCACTATGAT
AGTCTTAAAGGTCTAAGTTCTTGGGCATATCAAACGCTAGATGCACATCG
CAAGGACAAGCGAGATCCCTGCTACAGCTTAGAAGAACTAGAAAAGTCTC
TCACTTATGACGACCTGTGGAACTCGGCGCAACTGCAGCTGGTACGCGAG
GGAAAGATGCACGGCTTTTTGCGCATGTACTGGGCCAAAAAGATTCTGGA
ATGGACAGCGACACCGGAGCATGCGTTGGAGTACGCAATCCTGCTGAACG
ACAAGTACAGTCTGGATGGTCGCGACCCCAACGGCTATGTGGGCTGCATG
TGGTCCATTGGCGGCGTCCATGACATGGGCTGGAAGGAGCGGGCTATCTT
CGGTAAGGTTAGGTACATGAACTATCAGGGATGCCGTCGCAAATTCGATG
TAAATGCCTTTGTCATGCGATACGGCGGTAAGGTGCACAAGAAGAAATAA
AACGTTTTCGGATTTGCCTTTGTTTTGAATGCAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAA

TA01342.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:37:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG18853-RA 1148 CG18853-RA 49..1148 1..1100 5500 100 Plus
CG12822-RA 1526 CG12822-RA 31..645 1..615 3075 100 Plus
CG12822-RB 1472 CG12822-RB 31..645 1..615 3075 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:12:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 3716911..3717302 355..746 1960 100 Plus
chr2R 21145070 chr2R 3714253..3714640 745..1132 1940 100 Plus
chr2R 21145070 chr2R 3717363..3717750 745..1132 1940 100 Plus
chr2R 21145070 chr2R 3720021..3720281 355..615 1305 100 Plus
chr2R 21145070 chr2R 3716664..3716853 167..356 950 100 Plus
chr2R 21145070 chr2R 3719774..3719963 167..356 950 100 Plus
chr2R 21145070 chr2R 3716408..3716577 1..170 850 100 Plus
chr2R 21145070 chr2R 3719518..3719687 1..170 850 100 Plus
chr2R 21145070 chr2R 3714060..3714192 614..746 665 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:59:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:12:41
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7829590..7829981 355..746 1960 100 Plus
2R 25286936 2R 7826932..7827321 745..1134 1950 100 Plus
2R 25286936 2R 7830042..7830431 745..1134 1950 100 Plus
2R 25286936 2R 7832700..7832960 355..615 1305 100 Plus
2R 25286936 2R 7829343..7829532 167..356 950 100 Plus
2R 25286936 2R 7832453..7832642 167..356 950 100 Plus
2R 25286936 2R 7829087..7829256 1..170 850 100 Plus
2R 25286936 2R 7832197..7832366 1..170 850 100 Plus
2R 25286936 2R 7826739..7826871 614..746 665 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:33:57
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 7830789..7831180 355..746 1960 100 Plus
2R 25260384 2R 7831241..7831630 745..1134 1950 100 Plus
2R 25260384 2R 7828131..7828520 745..1134 1950 100 Plus
2R 25260384 2R 7833899..7834159 355..615 1305 100 Plus
2R 25260384 2R 7833652..7833841 167..356 950 100 Plus
2R 25260384 2R 7830542..7830731 167..356 950 100 Plus
2R 25260384 2R 7833396..7833565 1..170 850 100 Plus
2R 25260384 2R 7830286..7830455 1..170 850 100 Plus
2R 25260384 2R 7827938..7828070 614..746 665 100 Plus
Blast to na_te.dros performed 2019-03-15 16:12:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6712..6891 157..340 164 59.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6532..6590 305..364 117 68.3 Plus

TA01342.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:13:47 Download gff for TA01342.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 3716408..3716576 1..169 100 -> Plus
chr2R 3716667..3716853 170..356 100 -> Plus
chr2R 3716913..3717302 357..746 100 -> Plus
chr2R 3717365..3717750 747..1132 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:11:35 Download gff for TA01342.complete
Subject Subject Range Query Range Percent Splice Strand
CG18853-RA 1..993 108..1100 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:07:30 Download gff for TA01342.complete
Subject Subject Range Query Range Percent Splice Strand
CG18853-RA 1..993 108..1100 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:55:29 Download gff for TA01342.complete
Subject Subject Range Query Range Percent Splice Strand
CG18853-RA 1..993 108..1100 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:53:41 Download gff for TA01342.complete
Subject Subject Range Query Range Percent Splice Strand
CG18853-RA 1..993 108..1100 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:29:07 Download gff for TA01342.complete
Subject Subject Range Query Range Percent Splice Strand
CG18853-RA 1..993 108..1100 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:04:21 Download gff for TA01342.complete
Subject Subject Range Query Range Percent Splice Strand
CG18853-RA 31..1130 1..1100 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:07:30 Download gff for TA01342.complete
Subject Subject Range Query Range Percent Splice Strand
CG18853-RA 31..1162 1..1132 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:55:29 Download gff for TA01342.complete
Subject Subject Range Query Range Percent Splice Strand
CG18853-RA 26..1157 1..1132 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:53:41 Download gff for TA01342.complete
Subject Subject Range Query Range Percent Splice Strand
CG18853-RA 31..1130 1..1100 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:29:07 Download gff for TA01342.complete
Subject Subject Range Query Range Percent Splice Strand
CG18853-RA 26..1157 1..1132 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:13:47 Download gff for TA01342.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7829087..7829255 1..169 100 -> Plus
2R 7829346..7829532 170..356 100 -> Plus
2R 7829592..7829981 357..746 100 -> Plus
2R 7830044..7830429 747..1132 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:13:47 Download gff for TA01342.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7829087..7829255 1..169 100 -> Plus
2R 7829346..7829532 170..356 100 -> Plus
2R 7829592..7829981 357..746 100 -> Plus
2R 7830044..7830429 747..1132 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:13:47 Download gff for TA01342.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7829087..7829255 1..169 100 -> Plus
2R 7829346..7829532 170..356 100 -> Plus
2R 7829592..7829981 357..746 100 -> Plus
2R 7830044..7830429 747..1132 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:55:29 Download gff for TA01342.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3716592..3716760 1..169 100 -> Plus
arm_2R 3716851..3717037 170..356 100 -> Plus
arm_2R 3717097..3717486 357..746 100 -> Plus
arm_2R 3717549..3717934 747..1132 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:59:45 Download gff for TA01342.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7830791..7831180 357..746 100 -> Plus
2R 7831243..7831628 747..1132 100   Plus
2R 7830286..7830454 1..169 100 -> Plus
2R 7830545..7830731 170..356 100 -> Plus

TA01342.hyp Sequence

Translation from 2 to 1099

> TA01342.hyp
LDVTIENRGKYWSITAENAAIADYLGVKCALPAAKMHEDDLKSQLTIARN
EINNLRQQVRNLQHVQRKDIETITRLLQDFRCEGCANNNKSAKDKVAGEK
QEHQHQQQTQDQQTGQGQSNYTNGGHCLGEDYAHFRPIGVIRTAFPEKRA
VPRQSIVGSRLRGIIQLNDGVFTNPEHSLEGLEDFSHLWLIYHFHRNNSH
PKAKADNFCFYNEHYDSLKGLSSWAYQTLDAHRKDKRDPCYSLEELEKSL
TYDDLWNSAQLQLVREGKMHGFLRMYWAKKILEWTATPEHALEYAILLND
KYSLDGRDPNGYVGCMWSIGGVHDMGWKERAIFGKVRYMNYQGCRRKFDV
NAFVMRYGGKVHKKK*

TA01342.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:48:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG18853-PA 330 CG18853-PA 1..330 36..365 1805 100 Plus
CG12822-PB 394 CG12822-PB 1..203 36..248 907 83.8 Plus
CG12822-PA 412 CG12822-PA 1..203 36..248 907 83.8 Plus
phr-PB 535 CG11205-PB 375..535 205..365 899 100 Plus
phr-PA 555 CG11205-PA 395..555 205..365 899 100 Plus

TA01342.pep Sequence

Translation from 107 to 1099

> TA01342.pep
MHEDDLKSQLTIARNEINNLRQQVRNLQHVQRKDIETITRLLQDFRCEGC
ANNNKSAKDKVAGEKQEHQHQQQTQDQQTGQGQSNYTNGGHCLGEDYAHF
RPIGVIRTAFPEKRAVPRQSIVGSRLRGIIQLNDGVFTNPEHSLEGLEDF
SHLWLIYHFHRNNSHPKAKADNFCFYNEHYDSLKGLSSWAYQTLDAHRKD
KRDPCYSLEELEKSLTYDDLWNSAQLQLVREGKMHGFLRMYWAKKILEWT
ATPEHALEYAILLNDKYSLDGRDPNGYVGCMWSIGGVHDMGWKERAIFGK
VRYMNYQGCRRKFDVNAFVMRYGGKVHKKK*

TA01342.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:37:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13637-PA 538 GF13637-PA 376..536 170..330 869 95 Plus
Dana\GF13638-PA 398 GF13638-PA 1..207 1..213 679 66.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:37:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23307-PA 554 GG23307-PA 395..554 170..329 886 98.8 Plus
Dere\GG23308-PA 392 GG23308-PA 1..201 1..213 781 75.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:37:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21292-PA 530 GH21292-PA 368..528 170..330 801 86.3 Plus
Dgri\GH21293-PA 378 GH21293-PA 1..187 1..213 633 62.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG18853-PA 330 CG18853-PA 1..330 1..330 1805 100 Plus
CG12822-PB 394 CG12822-PB 1..203 1..213 907 83.8 Plus
CG12822-PA 412 CG12822-PA 1..203 1..213 907 83.8 Plus
phr-PB 535 CG11205-PB 375..535 170..330 899 100 Plus
phr-PA 555 CG11205-PA 395..555 170..330 899 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:37:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19782-PA 538 GI19782-PA 376..536 170..330 822 89.4 Plus
Dmoj\GI19783-PA 368 GI19783-PA 1..174 1..213 576 58.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:37:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17032-PA 540 GL17032-PA 379..539 170..330 855 93.2 Plus
Dper\GL11692-PA 389 GL11692-PA 1..199 1..213 629 63.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:37:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10839-PA 540 GA10839-PA 379..539 170..330 855 93.2 Plus
Dpse\GA11834-PA 388 GA11834-PA 1..198 1..213 638 63.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:37:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20985-PA 555 GM20985-PA 395..555 170..330 894 98.8 Plus
Dsec\GM20986-PA 392 GM20986-PA 1..201 1..213 796 77.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:37:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10512-PA 555 GD10512-PA 395..555 170..330 891 98.8 Plus
Dsim\GD10513-PA 376 GD10513-PA 1..157 1..159 698 91.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:37:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17708-PA 530 GJ17708-PA 368..528 170..330 814 88.2 Plus
Dvir\GJ17719-PA 394 GJ17719-PA 1..196 1..213 626 62.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:37:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19412-PA 534 GK19412-PA 371..531 170..330 781 83.9 Plus
Dwil\GK21968-PA 381 GK21968-PA 1..192 1..213 594 59.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:37:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19152-PA 535 GE19152-PA 375..535 170..330 874 96.9 Plus
Dyak\GE19153-PA 392 GE19153-PA 1..201 1..213 854 78.7 Plus