Associations are from manual ordering of a clone or by a periodic analysis.
Clone Sequence Records
TA01380.complete Sequence
605 bp assembled on 2009-01-21
GenBank Submission: BT056326.1
> TA01380.complete
ATTTGCGAACAAAACGCCCATCGAGGAGTTGGAAATGTGGAAACCGGACT
CCAAGGCGGGCATTATTTGCTCCGGGGCTGCATCGATCTGCCTTGCGATC
GCCTACCTCATCATATTCGCCAACTTGAGGGAATTATCCTACGCATTTGG
AGTTCACATAGCGTCCATGCAGATTATCAGCAGCGCAGTACTCATCGGCG
GAGCCATCAAGGAGAGGCACAAGCTCTTCGTGCCCTGGATGATCACAACC
GCCATGTTCCTCTACTTAATGGGTTACTCATCCATTGTGCTGCTGGCCAT
GGGCGATTGGTTAATCGTCATGTTTTGCGCAGCGCCAATGATAGGCTGCC
TCGGAATGGCATTCTATGCGGTGCAGAAGGCCTTCCGCAGGATGCGCAAG
GATGGGCTTCCACCGAAGTATGCCGACATGCAAGTCAAAAGTATTTTGGT
GAATCCCATATGATGCATTTTGCCATTTACAATTGTTGGTTTATCAAAAG
CATGATGCTTCTGAGATATGGTTATATATTTTGTCTTTACTAAATGCGAT
AATTATATATAATATGGTGAAGAGCAGAAAAAAAAAAAAAAAAAAAAAAA
AAAAA
TA01380.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:22:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12824-RB | 729 | CG12824-RB | 93..668 | 1..576 | 2865 | 99.8 | Plus |
CG12824-RA | 782 | CG12824-RA | 355..721 | 210..576 | 1820 | 99.7 | Plus |
CG12824-RA | 782 | CG12824-RA | 90..301 | 1..212 | 1060 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:45:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 3678198..3678431 | 343..576 | 1155 | 99.6 | Plus |
chr2R | 21145070 | chr2R | 3678012..3678147 | 210..345 | 680 | 100 | Plus |
chr2R | 21145070 | chr2R | 3677689..3677819 | 1..131 | 655 | 100 | Plus |
chr2R | 21145070 | chr2R | 3677877..3677958 | 131..212 | 410 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:59:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:45:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 7790877..7791110 | 343..576 | 1155 | 99.6 | Plus |
2R | 25286936 | 2R | 7790691..7790826 | 210..345 | 680 | 100 | Plus |
2R | 25286936 | 2R | 7790368..7790498 | 1..131 | 655 | 100 | Plus |
2R | 25286936 | 2R | 7790556..7790637 | 131..212 | 410 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:39:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 7792076..7792309 | 343..576 | 1155 | 99.5 | Plus |
2R | 25260384 | 2R | 7791890..7792025 | 210..345 | 680 | 100 | Plus |
2R | 25260384 | 2R | 7791567..7791697 | 1..131 | 655 | 100 | Plus |
2R | 25260384 | 2R | 7791755..7791836 | 131..212 | 410 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 14:45:52 has no hits.
TA01380.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:47:01 Download gff for
TA01380.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 3677689..3677819 | 1..131 | 100 | -> | Plus |
chr2R | 3677878..3677957 | 132..211 | 100 | -> | Plus |
chr2R | 3678014..3678146 | 212..344 | 100 | -> | Plus |
chr2R | 3678200..3678431 | 345..577 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:04:43 Download gff for
TA01380.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12824-RB | 1..429 | 35..463 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:33:11 Download gff for
TA01380.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12824-RB | 1..429 | 35..463 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:37:04 Download gff for
TA01380.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12824-RB | 1..429 | 35..463 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:34:41 Download gff for
TA01380.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12824-RB | 1..429 | 35..463 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-01-21 19:08:53 Download gff for
TA01380.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12824-RB | 1..553 | 24..577 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:33:10 Download gff for
TA01380.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12824-RB | 1..553 | 24..577 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:37:04 Download gff for
TA01380.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12824-RB | 1..576 | 1..577 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:34:41 Download gff for
TA01380.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12824-RB | 1..575 | 1..575 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:47:01 Download gff for
TA01380.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 7790557..7790636 | 132..211 | 100 | -> | Plus |
2R | 7790693..7790825 | 212..344 | 100 | -> | Plus |
2R | 7790879..7791110 | 345..577 | 99 | | Plus |
2R | 7790368..7790498 | 1..131 | 100 | -> | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:47:01 Download gff for
TA01380.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 7790557..7790636 | 132..211 | 100 | -> | Plus |
2R | 7790693..7790825 | 212..344 | 100 | -> | Plus |
2R | 7790879..7791110 | 345..577 | 99 | | Plus |
2R | 7790368..7790498 | 1..131 | 100 | -> | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:47:01 Download gff for
TA01380.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 7790557..7790636 | 132..211 | 100 | -> | Plus |
2R | 7790693..7790825 | 212..344 | 100 | -> | Plus |
2R | 7790879..7791110 | 345..577 | 99 | | Plus |
2R | 7790368..7790498 | 1..131 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:37:04 Download gff for
TA01380.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 3678384..3678615 | 345..577 | 99 | | Plus |
arm_2R | 3677873..3678003 | 1..131 | 100 | -> | Plus |
arm_2R | 3678062..3678141 | 132..211 | 100 | -> | Plus |
arm_2R | 3678198..3678330 | 212..344 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:06:23 Download gff for
TA01380.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 7792078..7792309 | 345..577 | 99 | | Plus |
2R | 7791567..7791697 | 1..131 | 100 | -> | Plus |
2R | 7791756..7791835 | 132..211 | 100 | -> | Plus |
2R | 7791892..7792024 | 212..344 | 100 | -> | Plus |
TA01380.hyp Sequence
Translation from 0 to 542
> TA01380.hyp
ICEQNAHRGVGNVETGLQGGHYLLRGCIDLPCDRLPHHIRQLEGIILRIW
SSHSVHADYQQRSTHRRSHQGEAQALRALDDHNRHVPLLNGLLIHCAAGH
GRLVNRHVLRSANDRLPRNGILCGAEGLPQDAQGWASTEVCRHASQKYFG
ESHMMHFAIYNCWFIKSMMLLRYGYIFCLY*
Sequence TA01380.hyp has no blast hits.
TA01380.pep Sequence
Translation from 1 to 462
> TA01380.pep
FANKTPIEELEMWKPDSKAGIICSGAASICLAIAYLIIFANLRELSYAFG
VHIASMQIISSAVLIGGAIKERHKLFVPWMITTAMFLYLMGYSSIVLLAM
GDWLIVMFCAAPMIGCLGMAFYAVQKAFRRMRKDGLPPKYADMQVKSILV
NPI*
TA01380.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:09:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF13201-PA | 144 | GF13201-PA | 1..144 | 12..153 | 342 | 51 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:09:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG23302-PA | 138 | GG23302-PA | 1..135 | 12..149 | 302 | 48.2 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:27:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12824-PB | 142 | CG12824-PB | 1..142 | 12..153 | 730 | 100 | Plus |
CG12825-PA | 144 | CG12825-PA | 1..144 | 12..153 | 327 | 49 | Plus |
CG12824-PA | 87 | CG12824-PA | 1..62 | 12..73 | 296 | 96.8 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:09:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL10838-PA | 142 | GL10838-PA | 1..142 | 12..153 | 269 | 40.6 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:09:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA11836-PA | 142 | GA11836-PA | 1..142 | 12..153 | 259 | 39.9 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:09:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM20980-PA | 144 | GM20980-PA | 1..144 | 12..153 | 318 | 49 | Plus |
Dsec\GM20981-PA | 109 | GM20981-PA | 1..91 | 12..97 | 247 | 59 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:09:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD15357-PA | 142 | GD15357-PA | 1..142 | 12..153 | 667 | 92.3 | Plus |
Dsim\GD10509-PA | 147 | GD10509-PA | 1..147 | 12..153 | 545 | 73.1 | Plus |
Dsim\GD10508-PA | 144 | GD10508-PA | 1..144 | 12..153 | 309 | 48.3 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:09:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK21717-PA | 144 | GK21717-PA | 1..144 | 12..153 | 225 | 36.6 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:09:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE19148-PA | 144 | GE19148-PA | 1..144 | 12..153 | 337 | 49.7 | Plus |