Clone TA01380 Report

Search the DGRC for TA01380

Clone and Library Details

Library:TA
Tissue Source:D melanogaster total adult RNA
Created by: 
Date Registered:2007-04-30
Comments: 
Original Plate Number:13
Well:80
Vector:pOTB7_DraIII
Associated Gene/TranscriptCG12824-RB
Protein status:TA01380.pep: gold
Sequenced Size:605

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12824-RB 2008-01-01 Library screening

Clone Sequence Records

TA01380.complete Sequence

605 bp assembled on 2009-01-21

GenBank Submission: BT056326.1

> TA01380.complete
ATTTGCGAACAAAACGCCCATCGAGGAGTTGGAAATGTGGAAACCGGACT
CCAAGGCGGGCATTATTTGCTCCGGGGCTGCATCGATCTGCCTTGCGATC
GCCTACCTCATCATATTCGCCAACTTGAGGGAATTATCCTACGCATTTGG
AGTTCACATAGCGTCCATGCAGATTATCAGCAGCGCAGTACTCATCGGCG
GAGCCATCAAGGAGAGGCACAAGCTCTTCGTGCCCTGGATGATCACAACC
GCCATGTTCCTCTACTTAATGGGTTACTCATCCATTGTGCTGCTGGCCAT
GGGCGATTGGTTAATCGTCATGTTTTGCGCAGCGCCAATGATAGGCTGCC
TCGGAATGGCATTCTATGCGGTGCAGAAGGCCTTCCGCAGGATGCGCAAG
GATGGGCTTCCACCGAAGTATGCCGACATGCAAGTCAAAAGTATTTTGGT
GAATCCCATATGATGCATTTTGCCATTTACAATTGTTGGTTTATCAAAAG
CATGATGCTTCTGAGATATGGTTATATATTTTGTCTTTACTAAATGCGAT
AATTATATATAATATGGTGAAGAGCAGAAAAAAAAAAAAAAAAAAAAAAA
AAAAA

TA01380.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:22:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG12824-RB 729 CG12824-RB 93..668 1..576 2865 99.8 Plus
CG12824-RA 782 CG12824-RA 355..721 210..576 1820 99.7 Plus
CG12824-RA 782 CG12824-RA 90..301 1..212 1060 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:45:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 3678198..3678431 343..576 1155 99.6 Plus
chr2R 21145070 chr2R 3678012..3678147 210..345 680 100 Plus
chr2R 21145070 chr2R 3677689..3677819 1..131 655 100 Plus
chr2R 21145070 chr2R 3677877..3677958 131..212 410 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:59:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:45:52
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7790877..7791110 343..576 1155 99.6 Plus
2R 25286936 2R 7790691..7790826 210..345 680 100 Plus
2R 25286936 2R 7790368..7790498 1..131 655 100 Plus
2R 25286936 2R 7790556..7790637 131..212 410 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:39:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 7792076..7792309 343..576 1155 99.5 Plus
2R 25260384 2R 7791890..7792025 210..345 680 100 Plus
2R 25260384 2R 7791567..7791697 1..131 655 100 Plus
2R 25260384 2R 7791755..7791836 131..212 410 100 Plus
Blast to na_te.dros performed on 2019-03-16 14:45:52 has no hits.

TA01380.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:47:01 Download gff for TA01380.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 3677689..3677819 1..131 100 -> Plus
chr2R 3677878..3677957 132..211 100 -> Plus
chr2R 3678014..3678146 212..344 100 -> Plus
chr2R 3678200..3678431 345..577 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:04:43 Download gff for TA01380.complete
Subject Subject Range Query Range Percent Splice Strand
CG12824-RB 1..429 35..463 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:33:11 Download gff for TA01380.complete
Subject Subject Range Query Range Percent Splice Strand
CG12824-RB 1..429 35..463 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:37:04 Download gff for TA01380.complete
Subject Subject Range Query Range Percent Splice Strand
CG12824-RB 1..429 35..463 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:34:41 Download gff for TA01380.complete
Subject Subject Range Query Range Percent Splice Strand
CG12824-RB 1..429 35..463 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-01-21 19:08:53 Download gff for TA01380.complete
Subject Subject Range Query Range Percent Splice Strand
CG12824-RB 1..553 24..577 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:33:10 Download gff for TA01380.complete
Subject Subject Range Query Range Percent Splice Strand
CG12824-RB 1..553 24..577 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:37:04 Download gff for TA01380.complete
Subject Subject Range Query Range Percent Splice Strand
CG12824-RB 1..576 1..577 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:34:41 Download gff for TA01380.complete
Subject Subject Range Query Range Percent Splice Strand
CG12824-RB 1..575 1..575 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:47:01 Download gff for TA01380.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7790557..7790636 132..211 100 -> Plus
2R 7790693..7790825 212..344 100 -> Plus
2R 7790879..7791110 345..577 99   Plus
2R 7790368..7790498 1..131 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:47:01 Download gff for TA01380.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7790557..7790636 132..211 100 -> Plus
2R 7790693..7790825 212..344 100 -> Plus
2R 7790879..7791110 345..577 99   Plus
2R 7790368..7790498 1..131 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:47:01 Download gff for TA01380.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7790557..7790636 132..211 100 -> Plus
2R 7790693..7790825 212..344 100 -> Plus
2R 7790879..7791110 345..577 99   Plus
2R 7790368..7790498 1..131 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:37:04 Download gff for TA01380.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3678384..3678615 345..577 99   Plus
arm_2R 3677873..3678003 1..131 100 -> Plus
arm_2R 3678062..3678141 132..211 100 -> Plus
arm_2R 3678198..3678330 212..344 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:06:23 Download gff for TA01380.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7792078..7792309 345..577 99   Plus
2R 7791567..7791697 1..131 100 -> Plus
2R 7791756..7791835 132..211 100 -> Plus
2R 7791892..7792024 212..344 100 -> Plus

TA01380.hyp Sequence

Translation from 0 to 542

> TA01380.hyp
ICEQNAHRGVGNVETGLQGGHYLLRGCIDLPCDRLPHHIRQLEGIILRIW
SSHSVHADYQQRSTHRRSHQGEAQALRALDDHNRHVPLLNGLLIHCAAGH
GRLVNRHVLRSANDRLPRNGILCGAEGLPQDAQGWASTEVCRHASQKYFG
ESHMMHFAIYNCWFIKSMMLLRYGYIFCLY*
Sequence TA01380.hyp has no blast hits.

TA01380.pep Sequence

Translation from 1 to 462

> TA01380.pep
FANKTPIEELEMWKPDSKAGIICSGAASICLAIAYLIIFANLRELSYAFG
VHIASMQIISSAVLIGGAIKERHKLFVPWMITTAMFLYLMGYSSIVLLAM
GDWLIVMFCAAPMIGCLGMAFYAVQKAFRRMRKDGLPPKYADMQVKSILV
NPI*

TA01380.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:09:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13201-PA 144 GF13201-PA 1..144 12..153 342 51 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:09:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23302-PA 138 GG23302-PA 1..135 12..149 302 48.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:27:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG12824-PB 142 CG12824-PB 1..142 12..153 730 100 Plus
CG12825-PA 144 CG12825-PA 1..144 12..153 327 49 Plus
CG12824-PA 87 CG12824-PA 1..62 12..73 296 96.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:09:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10838-PA 142 GL10838-PA 1..142 12..153 269 40.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:09:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11836-PA 142 GA11836-PA 1..142 12..153 259 39.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:09:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20980-PA 144 GM20980-PA 1..144 12..153 318 49 Plus
Dsec\GM20981-PA 109 GM20981-PA 1..91 12..97 247 59 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:09:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15357-PA 142 GD15357-PA 1..142 12..153 667 92.3 Plus
Dsim\GD10509-PA 147 GD10509-PA 1..147 12..153 545 73.1 Plus
Dsim\GD10508-PA 144 GD10508-PA 1..144 12..153 309 48.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:09:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21717-PA 144 GK21717-PA 1..144 12..153 225 36.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:09:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19148-PA 144 GE19148-PA 1..144 12..153 337 49.7 Plus