Clone TA01394 Report

Search the DGRC for TA01394

Clone and Library Details

Library:TA
Tissue Source:D melanogaster total adult RNA
Created by: 
Date Registered:2007-04-30
Comments: 
Original Plate Number:13
Well:94
Vector:pOTB7_DraIII
Associated Gene/TranscriptCp15-RA
Protein status:TA01394.pep: gold
Sequenced Size:543

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Cp15 2008-04-29 Release 5.5 accounting
Cp15 2008-08-15 Release 5.9 accounting
Cp15 2008-12-18 5.12 accounting

Clone Sequence Records

TA01394.complete Sequence

543 bp assembled on 2007-08-08

GenBank Submission: BT031038

> TA01394.complete
ATAGTTTGATTGATTACCCCAAACCAACAAAACTAAGCACTCACCATGAA
GTACCTGATTGTCTGCGTTACCCTGGCCCTTTTCGCCTACATCAACGCCA
GCCCAGCGTACGGCAACCGTGGAGGTTATGGTGGTGGCTACGGTGGTGGC
TACGGTCCTGTTCAGCGCGTCGTCTACGAGGAGGTGCCCGCCTACGGACC
ATCCCGTGGCTACAACAGCTATCCCCGCAGCCTGCGATCGGAGGGTAATG
GAGGAAGTGCCGCTGCCGCTGCCGCCGCTTCCGCCGCTGCCGTGAATCCC
GGAACCTACAAGCAGTACGCCATTCCCTCCTACGAGTTGGATGGCGCTCG
CGGCTACGAGATCGGACACGGCTACGGCCAACGTGCTTACTAATTCTCGC
TTCATCGGCAGTGAATTGAACTATCGACTCCTTGCTAAAATCCTCGAGTG
GCTGTCATGGCGAAACTCTGAGAATCAGTGAATAAAAGCAGCTTGAACGC
AATGGAAAATACCGAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

TA01394.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:02:41
Subject Length Description Subject Range Query Range Score Percent Strand
Cp15-RA 708 Cp15-RA 58..579 1..522 2595 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:59:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 8720653..8721110 57..514 2260 99.6 Plus
chr3L 24539361 chr3L 8720526..8720582 1..57 285 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:59:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:59:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8728609..8729074 57..522 2315 99.8 Plus
3L 28110227 3L 8728482..8728538 1..57 285 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:57:58
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 8721709..8722174 57..522 2315 99.7 Plus
3L 28103327 3L 8721582..8721638 1..57 285 100 Plus
Blast to na_te.dros performed 2019-03-16 18:59:17
Subject Length Description Subject Range Query Range Score Percent Strand
blood 7410 blood BLOOD 7410bp 413..462 225..274 115 70 Plus

TA01394.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:00:21 Download gff for TA01394.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 8720526..8720582 1..57 100 -> Plus
chr3L 8720654..8721110 58..514 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:11:38 Download gff for TA01394.complete
Subject Subject Range Query Range Percent Splice Strand
Cp15-RA 1..348 46..393 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:00:08 Download gff for TA01394.complete
Subject Subject Range Query Range Percent Splice Strand
Cp15-RA 1..348 46..393 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:21:20 Download gff for TA01394.complete
Subject Subject Range Query Range Percent Splice Strand
Cp15-RA 1..348 46..393 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:59:39 Download gff for TA01394.complete
Subject Subject Range Query Range Percent Splice Strand
Cp15-RA 1..348 46..393 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:57:30 Download gff for TA01394.complete
Subject Subject Range Query Range Percent Splice Strand
Cp15-RA 1..348 46..393 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:25:21 Download gff for TA01394.complete
Subject Subject Range Query Range Percent Splice Strand
Cp15-RA 2..515 1..514 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:00:07 Download gff for TA01394.complete
Subject Subject Range Query Range Percent Splice Strand
Cp15-RA 2..515 1..514 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:21:20 Download gff for TA01394.complete
Subject Subject Range Query Range Percent Splice Strand
Cp15-RA 2..515 1..514 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:59:39 Download gff for TA01394.complete
Subject Subject Range Query Range Percent Splice Strand
Cp15-RA 2..515 1..514 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:57:30 Download gff for TA01394.complete
Subject Subject Range Query Range Percent Splice Strand
Cp15-RA 2..515 1..514 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:00:21 Download gff for TA01394.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8728482..8728538 1..57 100 -> Plus
3L 8728610..8729066 58..514 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:00:21 Download gff for TA01394.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8728482..8728538 1..57 100 -> Plus
3L 8728610..8729066 58..514 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:00:21 Download gff for TA01394.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8728482..8728538 1..57 100 -> Plus
3L 8728610..8729066 58..514 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:21:20 Download gff for TA01394.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8721582..8721638 1..57 100 -> Plus
arm_3L 8721710..8722166 58..514 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:35:38 Download gff for TA01394.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8721582..8721638 1..57 100 -> Plus
3L 8721710..8722166 58..514 100   Plus

TA01394.pep Sequence

Translation from 45 to 392

> TA01394.pep
MKYLIVCVTLALFAYINASPAYGNRGGYGGGYGGGYGPVQRVVYEEVPAY
GPSRGYNSYPRSLRSEGNGGSAAAAAAASAAAVNPGTYKQYAIPSYELDG
ARGYEIGHGYGQRAY*

TA01394.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:33:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24348-PA 111 GF24348-PA 1..96 1..100 144 53.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:33:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14343-PA 111 GG14343-PA 1..111 1..115 368 89.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:41:40
Subject Length Description Subject Range Query Range Score Percent Strand
Cp15-PA 115 CG6519-PA 1..115 1..115 614 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:33:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10336-PA 118 GL10336-PA 1..116 1..111 147 53.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:33:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19658-PA 122 GA19658-PA 1..120 1..111 133 53.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:33:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25086-PA 111 GM25086-PA 1..111 1..115 388 92.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:33:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14122-PA 115 GD14122-PA 1..115 1..115 364 93.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:33:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20773-PA 122 GE20773-PA 1..122 1..115 332 80.5 Plus

TA01394.hyp Sequence

Translation from 45 to 392

> TA01394.hyp
MKYLIVCVTLALFAYINASPAYGNRGGYGGGYGGGYGPVQRVVYEEVPAY
GPSRGYNSYPRSLRSEGNGGSAAAAAAASAAAVNPGTYKQYAIPSYELDG
ARGYEIGHGYGQRAY*

TA01394.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:39:35
Subject Length Description Subject Range Query Range Score Percent Strand
Cp15-PA 115 CG6519-PA 1..115 1..115 614 100 Plus