Clone TA01420 Report

Search the DGRC for TA01420

Clone and Library Details

Library:TA
Tissue Source:D melanogaster total adult RNA
Created by: 
Date Registered:2007-04-30
Comments: 
Original Plate Number:14
Well:20
Vector:pOTB7_DraIII
Associated Gene/Transcriptprimo-1-RA
Protein status:TA01420.pep: gold
Sequenced Size:618

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
primo-1-RA 2008-01-01 Library screening

Clone Sequence Records

TA01420.complete Sequence

618 bp assembled on 2010-01-15

GenBank Submission: BT120134.1

> TA01420.complete
AATTGCGAGCCGGAAAAAAAACAACACACAAAATTGTTCGTAAAATTCCC
GTGTAAATTGACTCAAAGATGGTTCGAAAAGTGCTAATGATTTGTTTGGG
CAACATCTGCAGGTCCCCAATTGCGGAGGTCGTGATGGTGGACACCCTGG
AGAAGGCGAATGTCAAGGACGTGGAGGTCGATAGTGCAGCAATTGGTGGC
TGGCACGTGGGCAACCGCGCAGATCCGCGGGCCATCAGCACGCTGCAAAA
GCACGGCCTCAAGTGCACCCACATCGTTCGGCAGATCCGCAAGCAGGACT
TCTCGGAATTCGACTACATCTTCGGCATGGACGAGGACAACATGAGCGAG
CTAAGGCGTCTGGCGCCCAAGGGCTCCAAGGCGGAGCTCCTCATGCTGGG
CGATTTCGGACTTGAGAAGAAGAACCGCATCATTGAGGATCCCTACTATG
AGCGTGGAGCCGAGGGCTTTGAGACCGCCTATCAGCAGTGCGTGGTTGCC
TGTGCCGCCTTCATGAAAGAGCGCCTCCAGAAATGAATGATTTGTAAAAG
TGTTGTGATTTAGATAATCTAATAAATGTTGATACTTCAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAA

TA01420.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:34:24
Subject Length Description Subject Range Query Range Score Percent Strand
primo-2-RC 1358 primo-2-RC 762..1347 1..586 2930 100 Plus
primo-1-RA 1358 primo-1-RA 762..1347 1..586 2930 100 Plus
primo-1-RB 787 primo-1-RB 191..776 1..586 2930 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:17:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 9535193..9535544 450..99 1730 99.4 Minus
chr3R 27901430 chr3R 9534902..9535038 586..450 685 100 Minus
chr3R 27901430 chr3R 9535607..9535707 100..1 455 99 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:59:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:17:51
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13710308..13710659 450..99 1760 100 Minus
3R 32079331 3R 13710017..13710153 586..450 685 100 Minus
3R 32079331 3R 13710722..13710821 100..1 500 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:51:19
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 13451139..13451490 450..99 1760 100 Minus
3R 31820162 3R 13450848..13450984 586..450 685 100 Minus
3R 31820162 3R 13451553..13451652 100..1 500 100 Minus
Blast to na_te.dros performed 2019-03-15 17:17:52
Subject Length Description Subject Range Query Range Score Percent Strand
Rt1c 5443 Rt1c RT1C 5443bp 1053..1120 213..280 105 65.2 Plus

TA01420.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:18:54 Download gff for TA01420.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 9534900..9535038 450..588 98 <- Minus
chr3R 9535194..9535543 100..449 99 <- Minus
chr3R 9535608..9535707 1..99 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-01-15 13:33:11 Download gff for TA01420.complete
Subject Subject Range Query Range Percent Splice Strand
primo-1-RB 1..468 69..536 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:52:44 Download gff for TA01420.complete
Subject Subject Range Query Range Percent Splice Strand
primo-1-RB 1..468 69..536 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:31:27 Download gff for TA01420.complete
Subject Subject Range Query Range Percent Splice Strand
primo-1-RA 1..468 69..536 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:33:02 Download gff for TA01420.complete
Subject Subject Range Query Range Percent Splice Strand
primo-1-RA 1..468 69..536 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-01-15 13:33:09 Download gff for TA01420.complete
Subject Subject Range Query Range Percent Splice Strand
primo-1-RB 191..767 1..577 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:52:44 Download gff for TA01420.complete
Subject Subject Range Query Range Percent Splice Strand
primo-1-RB 191..767 1..577 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:31:27 Download gff for TA01420.complete
Subject Subject Range Query Range Percent Splice Strand
primo-1-RA 751..1336 1..586 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:33:02 Download gff for TA01420.complete
Subject Subject Range Query Range Percent Splice Strand
primo-2-RC 751..1336 1..586 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:18:54 Download gff for TA01420.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13710309..13710658 100..449 100 <- Minus
3R 13710723..13710821 1..99 100   Minus
3R 13710015..13710153 450..588 98 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:18:54 Download gff for TA01420.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13710309..13710658 100..449 100 <- Minus
3R 13710723..13710821 1..99 100   Minus
3R 13710015..13710153 450..588 98 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:18:54 Download gff for TA01420.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13710309..13710658 100..449 100 <- Minus
3R 13710723..13710821 1..99 100   Minus
3R 13710015..13710153 450..588 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:31:27 Download gff for TA01420.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9535737..9535875 450..588 98 <- Minus
arm_3R 9536445..9536543 1..99 100   Minus
arm_3R 9536031..9536380 100..449 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:28:57 Download gff for TA01420.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13451140..13451489 100..449 100 <- Minus
3R 13451554..13451652 1..99 100   Minus
3R 13450846..13450984 450..588 98 <- Minus

TA01420.hyp Sequence

Translation from 68 to 535

> TA01420.hyp
MVRKVLMICLGNICRSPIAEVVMVDTLEKANVKDVEVDSAAIGGWHVGNR
ADPRAISTLQKHGLKCTHIVRQIRKQDFSEFDYIFGMDEDNMSELRRLAP
KGSKAELLMLGDFGLEKKNRIIEDPYYERGAEGFETAYQQCVVACAAFMK
ERLQK*

TA01420.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:39:45
Subject Length Description Subject Range Query Range Score Percent Strand
primo-1-PB 155 CG33748-PB 1..155 1..155 805 100 Plus
primo-1-PA 155 CG33748-PA 1..155 1..155 805 100 Plus
primo-2-PC 164 CG33747-PC 10..157 5..151 397 50 Plus
CG31469-PA 164 CG31469-PA 2..151 4..150 318 41.3 Plus
CG14297-PA 250 CG14297-PA 4..148 3..145 227 34.9 Plus

TA01420.pep Sequence

Translation from 68 to 535

> TA01420.pep
MVRKVLMICLGNICRSPIAEVVMVDTLEKANVKDVEVDSAAIGGWHVGNR
ADPRAISTLQKHGLKCTHIVRQIRKQDFSEFDYIFGMDEDNMSELRRLAP
KGSKAELLMLGDFGLEKKNRIIEDPYYERGAEGFETAYQQCVVACAAFMK
ERLQK*

TA01420.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:27:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18147-PA 155 GF18147-PA 1..155 1..155 746 87.7 Plus
Dana\GF18146-PA 164 GF18146-PA 10..161 5..155 422 50.7 Plus
Dana\GF18148-PA 157 GF18148-PA 2..152 4..151 327 40.8 Plus
Dana\GF23217-PA 294 GF23217-PA 4..149 3..145 228 35.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:27:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17025-PA 155 GG17025-PA 1..155 1..155 821 99.4 Plus
Dere\GG17024-PA 164 GG17024-PA 10..157 5..151 422 51.4 Plus
Dere\GG17027-PA 165 GG17027-PA 2..152 4..151 333 41.1 Plus
Dere\GG23073-PA 249 GG23073-PA 4..148 3..145 210 32.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:27:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14046-PA 155 GH14046-PA 1..155 1..155 676 80 Plus
Dgri\GH14047-PA 155 GH14047-PA 2..153 4..152 342 42.1 Plus
Dgri\GH14045-PA 168 GH14045-PA 9..160 3..151 331 47.4 Plus
Dgri\GH14482-PA 234 GH14482-PA 4..139 3..138 215 34.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:36:10
Subject Length Description Subject Range Query Range Score Percent Strand
primo-1-PB 155 CG33748-PB 1..155 1..155 805 100 Plus
primo-1-PA 155 CG33748-PA 1..155 1..155 805 100 Plus
primo-2-PC 164 CG33747-PC 10..157 5..151 397 50 Plus
CG31469-PA 164 CG31469-PA 2..151 4..150 318 41.3 Plus
CG14297-PA 250 CG14297-PA 4..148 3..145 227 34.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:27:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24420-PA 156 GI24420-PA 4..154 3..153 653 78.8 Plus
Dmoj\GI24419-PA 165 GI24419-PA 8..159 3..151 402 50 Plus
Dmoj\GI24422-PA 157 GI24422-PA 2..151 4..150 330 43 Plus
Dmoj\GI22967-PA 239 GI22967-PA 4..148 3..145 228 35.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:27:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24448-PA 159 GL24448-PA 8..158 3..153 731 88.1 Plus
Dper\GL24449-PA 165 GL24449-PA 2..156 4..155 353 43.2 Plus
Dper\GL23438-PA 260 GL23438-PA 4..152 3..149 240 35.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:27:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16170-PB 154 GA16170-PB 1..153 1..153 758 91.5 Plus
Dpse\GA16170-PC 137 GA16170-PC 1..127 1..127 625 90.6 Plus
Dpse\GA16272-PA 165 GA16272-PA 2..156 4..155 357 43.2 Plus
Dpse\GA12886-PA 260 GA12886-PA 4..152 3..149 240 35.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:27:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25909-PA 155 GM25909-PA 1..155 1..155 818 98.7 Plus
Dsec\GM25908-PA 164 GM25908-PA 10..157 5..151 409 50.7 Plus
Dsec\GM25911-PA 159 GM25911-PA 2..152 4..151 327 41.1 Plus
Dsec\GM17892-PA 250 GM17892-PA 4..148 3..145 234 34.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:27:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20477-PA 150 GD20477-PA 1..150 1..155 778 96.1 Plus
Dsim\GD20476-PA 164 GD20476-PA 10..161 5..155 410 50 Plus
Dsim\GD20478-PA 165 GD20478-PA 2..152 4..151 328 41.1 Plus
Dsim\GD19253-PA 250 GD19253-PA 4..148 3..145 237 34.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:27:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14279-PA 155 GJ14279-PA 1..155 1..155 704 81.9 Plus
Dvir\GJ14278-PA 168 GJ14278-PA 8..163 2..154 387 47.4 Plus
Dvir\GJ14280-PA 157 GJ14280-PA 2..153 4..152 352 43.4 Plus
Dvir\GJ14544-PA 235 GJ14544-PA 4..152 3..149 240 35.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:27:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13063-PA 155 GK13063-PA 1..155 1..155 721 85.8 Plus
Dwil\GK13060-PA 164 GK13060-PA 7..157 3..151 431 50.3 Plus
Dwil\GK13064-PA 160 GK13064-PA 2..153 4..152 352 44.4 Plus
Dwil\GK22744-PA 228 GK22744-PA 4..155 3..149 240 36.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:27:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\primo-1-PA 155 GE24418-PA 1..155 1..155 829 100 Plus
Dyak\GE24417-PA 164 GE24417-PA 9..157 4..151 416 49.7 Plus
Dyak\GE24419-PA 165 GE24419-PA 2..152 4..151 331 42.1 Plus
Dyak\GE25562-PA 249 GE25562-PA 4..148 3..145 221 34.2 Plus