BDGP Sequence Production Resources |
Search the DGRC for TA01433
Library: | TA |
Tissue Source: | D melanogaster total adult RNA |
Created by: | |
Date Registered: | 2007-04-30 |
Comments: | |
Original Plate Number: | 14 |
Well: | 33 |
Vector: | pOTB7_DraIII |
Associated Gene/Transcript | CG10320-RA |
Protein status: | TA01433.pep: gold |
Sequenced Size: | 437 |
Gene | Date | Evidence |
---|---|---|
CG10320 | 2008-04-29 | Release 5.5 accounting |
CG10320 | 2008-08-15 | Release 5.9 accounting |
CG10320 | 2008-12-18 | 5.12 accounting |
437 bp assembled on 2007-08-08
GenBank Submission: BT031040
> TA01433.complete AAAACAAATCGTTTACTGCTCATCTCTAAGTCAACTTACAGCAATGGGCG GACATCACGGCGAACCCTACACGGTGCCCCACGCATCGACCTACAAGGTG GAGAGTGTGCCCCAACTCGTGGAGGTGAAGGAGGCTCTGGGCCGCCAGGG ATTGAAGGATCCATGGCTGAGGAACGAAGTCTGGCGCTATGAGCCCAAGG CCTTCGGCACCCACAGATCCCGCCTGAACACCTTCCTTTTCCGCGGACTC GGCGTGGGATTCTGCGCTTTCCTGGCCACCGTCGCCGTGGAGTACGCGCT GGGCATTGGCAAGGGTCAGGGCGGCCATGGACATGGCCACGGTCACGAGG AACACGGAGATAAGGGCCACCATTAGATATACTGAATAAACCCATTGTGC TATCGCTCCAAAAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 17544791..17544925 | 37..171 | 100 | -> | Plus |
chr2R | 17544519..17544555 | 1..36 | 97 | -> | Plus |
chr2R | 17544985..17545222 | 172..409 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10320-RC | 1..333 | 44..376 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10320-RC | 1..333 | 44..376 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10320-RC | 1..333 | 44..376 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10320-RC | 1..333 | 44..376 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10320-RC | 1..333 | 44..376 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10320-RB | 1..398 | 7..409 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10320-RE | 1..408 | 2..409 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10320-RE | 1..405 | 5..409 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10320-RB | 1..398 | 7..409 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10320-RE | 1..405 | 5..409 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 21658540..21658777 | 172..409 | 100 | Plus | |
2R | 21658073..21658109 | 1..36 | 97 | -> | Plus |
2R | 21658346..21658480 | 37..171 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 21658540..21658777 | 172..409 | 100 | Plus | |
2R | 21658073..21658109 | 1..36 | 97 | -> | Plus |
2R | 21658346..21658480 | 37..171 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 21658540..21658777 | 172..409 | 100 | Plus | |
2R | 21658073..21658109 | 1..36 | 97 | -> | Plus |
2R | 21658346..21658480 | 37..171 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 17545578..17545614 | 1..36 | 97 | -> | Plus |
arm_2R | 17545851..17545985 | 37..171 | 100 | -> | Plus |
arm_2R | 17546045..17546282 | 172..409 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 21659272..21659308 | 1..36 | 97 | -> | Plus |
2R | 21659545..21659679 | 37..171 | 100 | -> | Plus |
2R | 21659739..21659976 | 172..409 | 100 | Plus |
Translation from 0 to 375
> TA01433.hyp KQIVYCSSLSQLTAMGGHHGEPYTVPHASTYKVESVPQLVEVKEALGRQG LKDPWLRNEVWRYEPKAFGTHRSRLNTFLFRGLGVGFCAFLATVAVEYAL GIGKGQGGHGHGHGHEEHGDKGHH*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG10320-PE | 110 | CG10320-PE | 1..110 | 15..124 | 616 | 100 | Plus |
CG10320-PD | 110 | CG10320-PD | 1..110 | 15..124 | 616 | 100 | Plus |
CG10320-PC | 110 | CG10320-PC | 1..110 | 15..124 | 616 | 100 | Plus |
CG10320-PB | 110 | CG10320-PB | 1..110 | 15..124 | 616 | 100 | Plus |
CG10320-PA | 110 | CG10320-PA | 1..110 | 15..124 | 616 | 100 | Plus |
Translation from 43 to 375
> TA01433.pep MGGHHGEPYTVPHASTYKVESVPQLVEVKEALGRQGLKDPWLRNEVWRYE PKAFGTHRSRLNTFLFRGLGVGFCAFLATVAVEYALGIGKGQGGHGHGHG HEEHGDKGHH*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF13256-PA | 111 | GF13256-PA | 1..111 | 1..110 | 419 | 84.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22125-PA | 110 | GG22125-PA | 1..110 | 1..110 | 556 | 96.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH22739-PA | 107 | GH22739-PA | 1..88 | 1..88 | 390 | 80.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
ND-B12-PE | 110 | CG10320-PE | 1..110 | 1..110 | 616 | 100 | Plus |
ND-B12-PD | 110 | CG10320-PD | 1..110 | 1..110 | 616 | 100 | Plus |
ND-B12-PC | 110 | CG10320-PC | 1..110 | 1..110 | 616 | 100 | Plus |
ND-B12-PB | 110 | CG10320-PB | 1..110 | 1..110 | 616 | 100 | Plus |
ND-B12-PA | 110 | CG10320-PA | 1..110 | 1..110 | 616 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI18523-PA | 108 | GI18523-PA | 1..89 | 1..88 | 389 | 84.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL10798-PA | 105 | GL10798-PA | 1..94 | 1..94 | 390 | 88.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA10242-PA | 105 | GA10242-PA | 1..94 | 1..94 | 386 | 87.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM15849-PA | 110 | GM15849-PA | 1..110 | 1..110 | 569 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ21387-PA | 111 | GJ21387-PA | 1..86 | 1..86 | 408 | 86 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19567-PA | 109 | GK19567-PA | 1..88 | 1..88 | 416 | 87.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE12209-PA | 110 | GE12209-PA | 1..110 | 1..110 | 562 | 98.2 | Plus |