Clone TA01433 Report

Search the DGRC for TA01433

Clone and Library Details

Library:TA
Tissue Source:D melanogaster total adult RNA
Created by: 
Date Registered:2007-04-30
Comments: 
Original Plate Number:14
Well:33
Vector:pOTB7_DraIII
Associated Gene/TranscriptCG10320-RA
Protein status:TA01433.pep: gold
Sequenced Size:437

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10320 2008-04-29 Release 5.5 accounting
CG10320 2008-08-15 Release 5.9 accounting
CG10320 2008-12-18 5.12 accounting

Clone Sequence Records

TA01433.complete Sequence

437 bp assembled on 2007-08-08

GenBank Submission: BT031040

> TA01433.complete
AAAACAAATCGTTTACTGCTCATCTCTAAGTCAACTTACAGCAATGGGCG
GACATCACGGCGAACCCTACACGGTGCCCCACGCATCGACCTACAAGGTG
GAGAGTGTGCCCCAACTCGTGGAGGTGAAGGAGGCTCTGGGCCGCCAGGG
ATTGAAGGATCCATGGCTGAGGAACGAAGTCTGGCGCTATGAGCCCAAGG
CCTTCGGCACCCACAGATCCCGCCTGAACACCTTCCTTTTCCGCGGACTC
GGCGTGGGATTCTGCGCTTTCCTGGCCACCGTCGCCGTGGAGTACGCGCT
GGGCATTGGCAAGGGTCAGGGCGGCCATGGACATGGCCACGGTCACGAGG
AACACGGAGATAAGGGCCACCATTAGATATACTGAATAAACCCATTGTGC
TATCGCTCCAAAAAAAAAAAAAAAAAAAAAAAAAAAA

TA01433.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:02:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG10320-RE 510 CG10320-RE 55..464 2..411 2050 100 Plus
CG10320-RB 507 CG10320-RB 55..459 2..411 1950 98.7 Plus
CG10320-RD 622 CG10320-RD 177..552 36..411 1880 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 13:15:24
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 17544983..17545222 170..409 1200 100 Plus
chr2R 21145070 chr2R 17544791..17544926 37..172 680 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:59:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 13:15:22
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21658538..21658779 170..411 1210 100 Plus
2R 25286936 2R 21658346..21658481 37..172 680 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:57:59
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21659737..21659978 170..411 1210 100 Plus
2R 25260384 2R 21659545..21659680 37..172 680 100 Plus
2R 25260384 2R 21659274..21659308 2..36 175 100 Plus
Blast to na_te.dros performed on 2019-03-15 13:15:23 has no hits.

TA01433.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 13:16:23 Download gff for TA01433.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 17544791..17544925 37..171 100 -> Plus
chr2R 17544519..17544555 1..36 97 -> Plus
chr2R 17544985..17545222 172..409 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:11:41 Download gff for TA01433.complete
Subject Subject Range Query Range Percent Splice Strand
CG10320-RC 1..333 44..376 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:00:11 Download gff for TA01433.complete
Subject Subject Range Query Range Percent Splice Strand
CG10320-RC 1..333 44..376 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:59:56 Download gff for TA01433.complete
Subject Subject Range Query Range Percent Splice Strand
CG10320-RC 1..333 44..376 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:59:44 Download gff for TA01433.complete
Subject Subject Range Query Range Percent Splice Strand
CG10320-RC 1..333 44..376 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:26:13 Download gff for TA01433.complete
Subject Subject Range Query Range Percent Splice Strand
CG10320-RC 1..333 44..376 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:25:25 Download gff for TA01433.complete
Subject Subject Range Query Range Percent Splice Strand
CG10320-RB 1..398 7..409 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:00:11 Download gff for TA01433.complete
Subject Subject Range Query Range Percent Splice Strand
CG10320-RE 1..408 2..409 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:59:56 Download gff for TA01433.complete
Subject Subject Range Query Range Percent Splice Strand
CG10320-RE 1..405 5..409 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:59:44 Download gff for TA01433.complete
Subject Subject Range Query Range Percent Splice Strand
CG10320-RB 1..398 7..409 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:26:13 Download gff for TA01433.complete
Subject Subject Range Query Range Percent Splice Strand
CG10320-RE 1..405 5..409 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:16:23 Download gff for TA01433.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21658540..21658777 172..409 100   Plus
2R 21658073..21658109 1..36 97 -> Plus
2R 21658346..21658480 37..171 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:16:23 Download gff for TA01433.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21658540..21658777 172..409 100   Plus
2R 21658073..21658109 1..36 97 -> Plus
2R 21658346..21658480 37..171 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:16:23 Download gff for TA01433.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21658540..21658777 172..409 100   Plus
2R 21658073..21658109 1..36 97 -> Plus
2R 21658346..21658480 37..171 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:59:56 Download gff for TA01433.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17545578..17545614 1..36 97 -> Plus
arm_2R 17545851..17545985 37..171 100 -> Plus
arm_2R 17546045..17546282 172..409 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:35:41 Download gff for TA01433.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21659272..21659308 1..36 97 -> Plus
2R 21659545..21659679 37..171 100 -> Plus
2R 21659739..21659976 172..409 100   Plus

TA01433.hyp Sequence

Translation from 0 to 375

> TA01433.hyp
KQIVYCSSLSQLTAMGGHHGEPYTVPHASTYKVESVPQLVEVKEALGRQG
LKDPWLRNEVWRYEPKAFGTHRSRLNTFLFRGLGVGFCAFLATVAVEYAL
GIGKGQGGHGHGHGHEEHGDKGHH*

TA01433.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:45:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG10320-PE 110 CG10320-PE 1..110 15..124 616 100 Plus
CG10320-PD 110 CG10320-PD 1..110 15..124 616 100 Plus
CG10320-PC 110 CG10320-PC 1..110 15..124 616 100 Plus
CG10320-PB 110 CG10320-PB 1..110 15..124 616 100 Plus
CG10320-PA 110 CG10320-PA 1..110 15..124 616 100 Plus

TA01433.pep Sequence

Translation from 43 to 375

> TA01433.pep
MGGHHGEPYTVPHASTYKVESVPQLVEVKEALGRQGLKDPWLRNEVWRYE
PKAFGTHRSRLNTFLFRGLGVGFCAFLATVAVEYALGIGKGQGGHGHGHG
HEEHGDKGHH*

TA01433.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 06:42:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13256-PA 111 GF13256-PA 1..111 1..110 419 84.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:42:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22125-PA 110 GG22125-PA 1..110 1..110 556 96.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 06:42:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22739-PA 107 GH22739-PA 1..88 1..88 390 80.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:33:29
Subject Length Description Subject Range Query Range Score Percent Strand
ND-B12-PE 110 CG10320-PE 1..110 1..110 616 100 Plus
ND-B12-PD 110 CG10320-PD 1..110 1..110 616 100 Plus
ND-B12-PC 110 CG10320-PC 1..110 1..110 616 100 Plus
ND-B12-PB 110 CG10320-PB 1..110 1..110 616 100 Plus
ND-B12-PA 110 CG10320-PA 1..110 1..110 616 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 06:42:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18523-PA 108 GI18523-PA 1..89 1..88 389 84.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 06:42:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10798-PA 105 GL10798-PA 1..94 1..94 390 88.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 06:42:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10242-PA 105 GA10242-PA 1..94 1..94 386 87.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 06:42:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15849-PA 110 GM15849-PA 1..110 1..110 569 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 06:42:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21387-PA 111 GJ21387-PA 1..86 1..86 408 86 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 06:42:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19567-PA 109 GK19567-PA 1..88 1..88 416 87.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:42:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12209-PA 110 GE12209-PA 1..110 1..110 562 98.2 Plus