Clone TA01441 Report

Search the DGRC for TA01441

Clone and Library Details

Library:TA
Tissue Source:D melanogaster total adult RNA
Created by: 
Date Registered:2007-04-30
Comments: 
Original Plate Number:14
Well:41
Vector:pOTB7_DraIII
Associated Gene/TranscriptCG10399-RA
Protein status:TA01441.pep: gold
Sequenced Size:1098

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10399 2008-04-29 Release 5.5 accounting
CG10399 2008-04-29 Picked prior to 5.5
CG10399 2008-08-15 Release 5.9 accounting
CG10399 2008-12-18 5.12 accounting

Clone Sequence Records

TA01441.complete Sequence

1098 bp assembled on 2007-09-19

GenBank Submission: BT031041

> TA01441.complete
TACTTACAAATTTAGCAATGATAAGTGCACCAATTCGCTCTATCCTTGCA
CTTACAGCAAAGCGCACGGCGGTTACAAGCGCGGCCAATCAGGTGCGAAT
TGTGGAGGTTGGACCGCGGGATGGTCTTCAAAACGAGCCCAAACTCCTGC
CGGCAGCCACCAAGATCGAGCTGATCAACCAATTGTCCGAAACAGGACTG
CGAACCATAGAAGCCACCAGCTTTGTGAGCGCCAAATGGGTGCCACAGAT
GGGCGACAATGCCGAAGTGCTGAAAGGAATCCGCAAAGTGACTGGTATAA
GCTATCCAGTCCTCACGCCTAATCTGAAGGGATTCGAGAGTGCTCTGGAG
GCGGGAGCCGAGGAGGTGGCAGTCTTTGGAGCCGCATCTGATGCGTTTTC
GCTGAAGAACGTTAATTGCACGGCAGCTGAGGCCATCGAACGATTTAAAC
CTGTGCTGAAAGCAGCCCAAAAGCATGGTGTGCGCGTCCGGGGCTACGTT
TCCACCGTGGTTGGCTGCCCGTACGAGGGTGCTGTTGCGCCGAGTGCTGT
CGTCAAAGTGGTGGAAGCCCTGTACCAAATGGGCTGCTATGAGATCTCAT
TGGGCGACACCATTGGTGTGGGCACTCCAGGCACAATGCGCCGAATGCTG
GATGAGGTGACCAAGGTCGTCCCGGCTAAAGATCTGGCCGTGCACTGCCA
CGACACTTATGGTCAGGCTCTGAGCAACATACTGGTCTCACTGGACTATG
GCATTCGGGTGGTGGACTCTTCCGTTTCTGGCTTGGGCGGATGTCCTTAC
GCCAAGGGGGCGTCAGGCAACGCAGCCACCGAGGATGTGGTCTACTTACT
GCACGGCATGGGCCTCGATACTGGCGTCAACCTAGACAAACTGATCCAAG
TGGGGCGGTACATCTGCACCGAACTGGGCAGAACCTCAGAGTCCAAGGTT
AATCGAGCGTGGAAGGGACCGCAGGCGCGAGTTAAGTGATGATGCAAGCA
TTGATACTATCAAACGAAAACGAAGGCATTTACTAGCACTAGTTACACAA
TACATTTATTATCGTTGCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

TA01441.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:37:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG10399-RA 1117 CG10399-RA 53..1117 4..1068 5325 100 Plus
sip2_CG9188-RE 2150 sip2_CG9188-RE 2067..2150 1070..987 420 100 Minus
sip2_CG9188-RA 2288 sip2_CG9188-RA 2205..2288 1070..987 420 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:13:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 6959629..6960636 61..1068 5010 99.8 Plus
chr2L 23010047 chr2L 6959513..6959571 4..62 280 98.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:59:34 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:13:44
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6960545..6961554 61..1070 5050 100 Plus
2L 23513712 2L 6960429..6960487 4..62 295 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:33:59
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6960545..6961554 61..1070 5050 100 Plus
2L 23513712 2L 6960429..6960487 4..62 295 100 Plus
Blast to na_te.dros performed on 2019-03-15 20:13:45 has no hits.

TA01441.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:14:36 Download gff for TA01441.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 6959510..6959571 1..62 96 -> Plus
chr2L 6959631..6960636 63..1068 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:11:41 Download gff for TA01441.complete
Subject Subject Range Query Range Percent Splice Strand
CG10399-RA 1..972 18..989 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:07:32 Download gff for TA01441.complete
Subject Subject Range Query Range Percent Splice Strand
CG10399-RA 1..972 18..989 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 04:49:53 Download gff for TA01441.complete
Subject Subject Range Query Range Percent Splice Strand
CG10399-RA 1..972 18..989 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:53:43 Download gff for TA01441.complete
Subject Subject Range Query Range Percent Splice Strand
CG10399-RA 1..972 18..989 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:31:26 Download gff for TA01441.complete
Subject Subject Range Query Range Percent Splice Strand
CG10399-RA 1..972 18..989 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:04:25 Download gff for TA01441.complete
Subject Subject Range Query Range Percent Splice Strand
CG10399-RA 1..972 18..989 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:07:32 Download gff for TA01441.complete
Subject Subject Range Query Range Percent Splice Strand
CG10399-RA 1..1068 1..1068 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:49:53 Download gff for TA01441.complete
Subject Subject Range Query Range Percent Splice Strand
CG10399-RA 50..1117 1..1068 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:53:43 Download gff for TA01441.complete
Subject Subject Range Query Range Percent Splice Strand
CG10399-RA 1..972 18..989 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:31:26 Download gff for TA01441.complete
Subject Subject Range Query Range Percent Splice Strand
CG10399-RA 50..1117 1..1068 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:14:36 Download gff for TA01441.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6960426..6960487 1..62 98 -> Plus
2L 6960547..6961552 63..1068 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:14:36 Download gff for TA01441.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6960426..6960487 1..62 98 -> Plus
2L 6960547..6961552 63..1068 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:14:36 Download gff for TA01441.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6960426..6960487 1..62 98 -> Plus
2L 6960547..6961552 63..1068 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:49:53 Download gff for TA01441.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 6960426..6960487 1..62 98 -> Plus
arm_2L 6960547..6961552 63..1068 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:59:47 Download gff for TA01441.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6960547..6961552 63..1068 100   Plus
2L 6960426..6960487 1..62 98 -> Plus

TA01441.hyp Sequence

Translation from 2 to 988

> TA01441.hyp
FTNLAMISAPIRSILALTAKRTAVTSAANQVRIVEVGPRDGLQNEPKLLP
AATKIELINQLSETGLRTIEATSFVSAKWVPQMGDNAEVLKGIRKVTGIS
YPVLTPNLKGFESALEAGAEEVAVFGAASDAFSLKNVNCTAAEAIERFKP
VLKAAQKHGVRVRGYVSTVVGCPYEGAVAPSAVVKVVEALYQMGCYEISL
GDTIGVGTPGTMRRMLDEVTKVVPAKDLAVHCHDTYGQALSNILVSLDYG
IRVVDSSVSGLGGCPYAKGASGNAATEDVVYLLHGMGLDTGVNLDKLIQV
GRYICTELGRTSESKVNRAWKGPQARVK*

TA01441.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:18:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG10399-PB 323 CG10399-PB 1..323 6..328 1631 100 Plus
CG10399-PA 323 CG10399-PA 1..323 6..328 1631 100 Plus

TA01441.pep Sequence

Translation from 17 to 988

> TA01441.pep
MISAPIRSILALTAKRTAVTSAANQVRIVEVGPRDGLQNEPKLLPAATKI
ELINQLSETGLRTIEATSFVSAKWVPQMGDNAEVLKGIRKVTGISYPVLT
PNLKGFESALEAGAEEVAVFGAASDAFSLKNVNCTAAEAIERFKPVLKAA
QKHGVRVRGYVSTVVGCPYEGAVAPSAVVKVVEALYQMGCYEISLGDTIG
VGTPGTMRRMLDEVTKVVPAKDLAVHCHDTYGQALSNILVSLDYGIRVVD
SSVSGLGGCPYAKGASGNAATEDVVYLLHGMGLDTGVNLDKLIQVGRYIC
TELGRTSESKVNRAWKGPQARVK*

TA01441.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:55:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15438-PA 329 GF15438-PA 12..327 7..321 1450 86.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:55:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10447-PA 323 GG10447-PA 5..323 5..323 1614 96.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:55:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13343-PA 306 GH13343-PA 7..300 24..317 1318 86.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:14:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG10399-PB 323 CG10399-PB 1..323 1..323 1631 100 Plus
CG10399-PA 323 CG10399-PA 1..323 1..323 1631 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:55:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17729-PA 306 GI17729-PA 9..304 26..321 1418 87.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:55:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26197-PA 327 GL26197-PA 12..326 7..321 1506 88.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:55:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10298-PA 327 GA10298-PA 12..326 7..321 1505 88.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:55:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16259-PA 323 GM16259-PA 1..323 1..323 1677 98.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:55:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17557-PA 329 GJ17557-PA 17..327 13..321 1435 86.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:55:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18282-PA 333 GK18282-PA 20..329 14..317 1411 85.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:55:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14242-PA 323 GE14242-PA 1..323 1..323 1638 96.6 Plus