Clone TA01534 Report

Search the DGRC for TA01534

Clone and Library Details

Library:TA
Tissue Source:D melanogaster total adult RNA
Created by: 
Date Registered:2007-04-30
Comments: 
Original Plate Number:15
Well:34
Vector:pOTB7_DraIII
Associated Gene/TranscriptPGRP-SD-RA
Protein status:TA01534.pep: gold
Sequenced Size:740

Clone Sequence Records

TA01534.complete Sequence

740 bp assembled on 2011-03-18

GenBank Submission: BT126225.1

> TA01534.complete
GTCAGTTGACAGACACGCAAGTGGAATGACTTGGATCGGTTTGCTCATCG
TTGGCCTCACAGCAATCGCTGTCCAGGGGGAAGTACCGATCGTGACGAGG
GCCGAGTGGAATGCCAAACCGCCGAACGGAGCCATAGACAGCATGGAAAC
TCCCTTGCCACGTGCTGTGATCGCCCATACAGCTGGAGGAGCTTGTGCGG
ATGATGTTACATGCTCCCAGCACATGCAAAATCTGCAAAACTTCCAGATG
TCCAAGCAAAAGTTCTCGGACATTGGCTACCACTATCTGATCGGCGGTAA
TGGCAAGGTATACGAAGGCAGAAGTCCAAGCCAGAGAGGAGCCTTTGCCG
GTCCCAATAACGATGGTTCCCTGGGCATTGCGTTTATTGGTAACTTCGAA
GAACGGGCGCCCAACAAGGAGGCCTTGGATGCCGCCAAGGAGCTGCTGGA
GCAGGCTGTCAAACAGGCTCAGCTGGTGGAGGGCTATAAGTTACTGGGCC
ATCGTCAAGTCAGTGCTACCAAGAGTCCTGGAGAAGCACTCTACGCTCTG
ATACAGCAGTGGCCCAACTGGTCCGAAGAAATGTGAAATATAGAGTGTGC
ATTGCATAAGGTTTCGACACGTAAAGACCACTCCTTACACATTTATTTGT
AAATATAATTATGTATAATTTGTTTTTTTTTTTTTGCTTAAATACGAATA
CTAAAATTGTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

TA01534.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:31:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 7643309..7644017 1..708 3420 99.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:31:17
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7651180..7651892 1..712 3500 99.7 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:08:43
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 7644280..7644992 1..712 3510 99.7 Plus
Blast to na_te.dros performed on 2019-03-16 22:31:17 has no hits.

TA01534.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:32:11 Download gff for TA01534.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 7643309..7644018 1..710 92   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-18 10:21:56 Download gff for TA01534.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-SD-RA 1..561 26..586 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:56:41 Download gff for TA01534.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-SD-RA 1..561 26..586 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:28:57 Download gff for TA01534.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-SD-RA 1..561 26..586 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-18 10:21:56 Download gff for TA01534.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-SD-RA 1..685 26..710 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:56:41 Download gff for TA01534.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-SD-RA 1..710 1..710 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:28:57 Download gff for TA01534.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-SD-RA 1..710 1..710 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:32:11 Download gff for TA01534.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7651180..7651889 1..710 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:32:11 Download gff for TA01534.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7651180..7651889 1..710 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:32:11 Download gff for TA01534.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7651180..7651889 1..710 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:56:41 Download gff for TA01534.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7644280..7644989 1..710 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:01:31 Download gff for TA01534.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7644280..7644989 1..710 99   Plus

TA01534.hyp Sequence

Translation from 0 to 585

> TA01534.hyp
SVDRHASGMTWIGLLIVGLTAIAVQGEVPIVTRAEWNAKPPNGAIDSMET
PLPRAVIAHTAGGACADDVTCSQHMQNLQNFQMSKQKFSDIGYHYLIGGN
GKVYEGRSPSQRGAFAGPNNDGSLGIAFIGNFEERAPNKEALDAAKELLE
QAVKQAQLVEGYKLLGHRQVSATKSPGEALYALIQQWPNWSEEM*

TA01534.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:09:00
Subject Length Description Subject Range Query Range Score Percent Strand
PGRP-SD-PA 186 CG7496-PA 1..186 9..194 976 100 Plus
PGRP-LC-PE 329 CG4432-PE 165..329 30..194 392 43.6 Plus
PGRP-LC-PD 500 CG4432-PD 336..500 30..194 392 43.6 Plus
PGRP-LC-PA 500 CG4432-PA 336..500 30..194 392 43.6 Plus
PGRP-SC2-PA 184 CG14745-PA 8..182 14..190 340 41.8 Plus

TA01534.pep Sequence

Translation from 1 to 585

> TA01534.pep
SVDRHASGMTWIGLLIVGLTAIAVQGEVPIVTRAEWNAKPPNGAIDSMET
PLPRAVIAHTAGGACADDVTCSQHMQNLQNFQMSKQKFSDIGYHYLIGGN
GKVYEGRSPSQRGAFAGPNNDGSLGIAFIGNFEERAPNKEALDAAKELLE
QAVKQAQLVEGYKLLGHRQVSATKSPGEALYALIQQWPNWSEEM*

TA01534.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:31:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10655-PA 188 GF10655-PA 5..188 11..194 714 68.5 Plus
Dana\GF12377-PA 185 GF12377-PA 9..184 14..191 348 39.9 Plus
Dana\GF21644-PA 185 GF21644-PA 9..184 14..191 348 39.9 Plus
Dana\GF21643-PA 185 GF21643-PA 9..184 14..191 348 39.9 Plus
Dana\GF10681-PA 371 GF10681-PA 35..223 6..194 346 34.4 Plus
Dana\GF10681-PA 371 GF10681-PA 236..366 30..165 149 25.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:31:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14444-PA 186 GG14444-PA 1..186 9..194 908 89.8 Plus
Dere\GG15356-PA 501 GG15356-PA 336..500 30..194 368 40.6 Plus
Dere\GG23381-PA 184 GG23381-PA 8..182 14..190 361 41.8 Plus
Dere\GG23379-PA 185 GG23379-PA 22..184 28..191 344 42.1 Plus
Dere\GG23380-PA 185 GG23380-PA 22..184 28..191 343 42.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:31:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14703-PA 194 GH14703-PA 8..192 9..194 537 54.3 Plus
Dgri\GH20540-PA 184 GH20540-PA 6..182 12..190 376 43 Plus
Dgri\GH21354-PA 184 GH21354-PA 6..182 12..190 365 43 Plus
Dgri\GH21355-PA 184 GH21355-PA 6..182 12..190 361 41.9 Plus
Dgri\GH17605-PA 199 GH17605-PA 31..195 26..190 335 41 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:51
Subject Length Description Subject Range Query Range Score Percent Strand
PGRP-SD-PA 186 CG7496-PA 1..186 9..194 976 100 Plus
PGRP-LC-PE 329 CG4432-PE 165..329 30..194 392 43.6 Plus
PGRP-LC-PD 500 CG4432-PD 336..500 30..194 392 43.6 Plus
PGRP-LC-PA 500 CG4432-PA 336..500 30..194 392 43.6 Plus
PGRP-SC2-PA 184 CG14745-PA 8..182 14..190 340 41.8 Plus
PGRP-LC-PJ 340 CG4432-PJ 158..326 22..190 328 35.5 Plus
PGRP-LC-PC 511 CG4432-PC 329..497 22..190 328 35.5 Plus
PGRP-SC1b-PB 185 CG8577-PB 22..184 28..191 327 40.9 Plus
PGRP-SC1b-PA 185 CG8577-PA 22..184 28..191 327 40.9 Plus
PGRP-SC1a-PA 185 CG14746-PA 22..184 28..191 327 40.9 Plus
PGRP-SA-PB 203 CG11709-PB 40..199 30..190 319 41.6 Plus
PGRP-SA-PA 203 CG11709-PA 40..199 30..190 319 41.6 Plus
PGRP-SB1-PA 190 CG9681-PA 4..189 6..192 314 34.5 Plus
PGRP-LF-PA 369 CG4437-PA 59..222 30..193 313 35.4 Plus
PGRP-SB2-PA 182 CG9697-PA 5..178 12..190 296 36.3 Plus
PGRP-LB-PF 215 CG14704-PF 15..176 30..191 294 37.4 Plus
PGRP-LB-PE 215 CG14704-PE 15..176 30..191 294 37.4 Plus
PGRP-LB-PA 215 CG14704-PA 15..176 30..191 294 37.4 Plus
PGRP-LB-PB 215 CG14704-PB 15..176 30..191 294 37.4 Plus
PGRP-LB-PC 232 CG14704-PC 32..193 30..191 294 37.4 Plus
PGRP-LB-PD 255 CG14704-PD 55..216 30..191 294 37.4 Plus
PGRP-LE-PB 345 CG8995-PB 177..337 30..190 252 33.5 Plus
PGRP-LE-PA 345 CG8995-PA 177..337 30..190 252 33.5 Plus
PGRP-LC-PK 330 CG4432-PK 166..330 31..191 230 31.5 Plus
PGRP-LC-PI 501 CG4432-PI 337..501 31..191 230 31.5 Plus
PGRP-LC-PH 520 CG4432-PH 356..520 31..191 230 31.5 Plus
PGRP-LC-PB 520 CG4432-PB 356..520 31..191 230 31.5 Plus
PGRP-SB2-PB 191 CG9697-PB 5..121 12..133 187 36.1 Plus
PGRP-LA-PF 299 CG32042-PF 114..273 30..190 183 26.8 Plus
PGRP-LA-PE 368 CG32042-PE 183..342 30..190 183 26.8 Plus
PGRP-LF-PA 369 CG4437-PA 234..363 28..165 149 26.8 Plus
PGRP-LA-PG 138 CG32042-PG 1..112 75..190 142 26.7 Plus
PGRP-LA-PC 138 CG32042-PC 1..112 75..190 142 26.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:31:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12249-PA 193 GI12249-PA 10..187 14..191 522 55.6 Plus
Dmoj\GI18809-PA 184 GI18809-PA 9..182 15..190 380 43.2 Plus
Dmoj\GI12108-PA 507 GI12108-PA 317..504 12..193 368 38.3 Plus
Dmoj\GI18808-PA 187 GI18808-PA 11..185 12..190 363 42.5 Plus
Dmoj\GI20770-PA 184 GI20770-PA 9..182 15..190 363 42.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:31:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26612-PA 185 GL26612-PA 19..184 27..192 691 74.1 Plus
Dper\GL18427-PA 462 GL18427-PA 294..462 26..194 383 40.8 Plus
Dper\GL18428-PA 180 GL18428-PA 10..180 22..192 371 39.2 Plus
Dper\GL17117-PA 185 GL17117-PA 22..184 28..191 348 41.5 Plus
Dper\GL17120-PA 185 GL17120-PA 22..184 28..191 348 41.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:31:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20392-PA 185 GA20392-PA 19..184 27..192 698 74.7 Plus
Dpse\GA29295-PA 508 GA29295-PA 340..508 26..194 379 40.2 Plus
Dpse\GA29296-PA 163 GA29296-PA 1..163 30..192 360 39.9 Plus
Dpse\GA13217-PA 184 GA13217-PA 8..182 14..190 356 40.1 Plus
Dpse\GA24974-PA 185 GA24974-PA 22..184 28..191 348 41.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:31:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14864-PA 95 GM14864-PA 10..95 109..194 423 93 Plus
Dsec\GM25129-PA 500 GM25129-PA 336..500 30..194 395 44.2 Plus
Dsec\GM14863-PA 91 GM14863-PA 1..73 9..81 373 94.5 Plus
Dsec\GM21059-PA 185 GM21059-PA 22..184 28..191 337 40.9 Plus
Dsec\GM21060-PA 185 GM21060-PA 22..184 28..191 335 40.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:31:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\PGRP-SD-PA 186 GD14029-PA 1..186 9..194 972 96.8 Plus
Dsim\GD14166-PA 500 GD14166-PA 336..500 30..194 396 44.2 Plus
Dsim\PGRP-SC2-PA 184 GD10595-PA 8..182 14..190 363 41.8 Plus
Dsim\PGRP-SC1b-PA 185 GD10594-PA 9..184 14..191 342 39.9 Plus
Dsim\PGRP-SC1a-PA 185 GD10593-PA 22..184 28..191 339 40.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:31:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11481-PA 189 GJ11481-PA 11..188 15..192 557 59.6 Plus
Dvir\GJ13383-PA 534 GJ13383-PA 372..531 35..194 378 43.1 Plus
Dvir\GJ20505-PA 184 GJ20505-PA 6..182 12..190 368 43 Plus
Dvir\GJ21836-PA 184 GJ21836-PA 8..182 14..190 360 40.1 Plus
Dvir\GJ21835-PA 187 GJ21835-PA 20..185 23..190 355 42.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:31:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23884-PA 198 GK23884-PA 15..195 16..193 579 59.7 Plus
Dwil\GK21737-PA 185 GK21737-PA 7..183 12..190 362 41.3 Plus
Dwil\GK23800-PA 541 GK23800-PA 365..533 26..194 358 38.5 Plus
Dwil\GK21567-PA 187 GK21567-PA 11..186 14..191 356 40.4 Plus
Dwil\GK25449-PA 199 GK25449-PA 1..196 9..193 337 37.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:31:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\PGRP-SD-PA 186 GE21635-PA 1..186 9..194 872 84.9 Plus
Dyak\GE20818-PA 500 GE20818-PA 328..500 22..194 388 40.5 Plus
Dyak\GE19223-PA 184 GE19223-PA 8..182 14..190 359 41.2 Plus
Dyak\GE19221-PA 185 GE19221-PA 22..184 28..191 346 41.5 Plus
Dyak\GE20819-PA 166 GE20819-PA 2..152 40..190 339 39.1 Plus