Clone TA01551 Report

Search the DGRC for TA01551

Clone and Library Details

Library:TA
Tissue Source:D melanogaster total adult RNA
Created by: 
Date Registered:2007-04-30
Comments: 
Original Plate Number:15
Well:51
Vector:pOTB7_DraIII
Associated Gene/TranscriptRpL37a-RA
Protein status:TA01551.pep: gold
Sequenced Size:591

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
RpL37a 2008-04-29 Release 5.5 accounting
RpL37a 2008-08-15 Release 5.9 accounting
RpL37a 2008-12-18 5.12 accounting

Clone Sequence Records

TA01551.complete Sequence

591 bp assembled on 2007-08-08

GenBank Submission: BT031045

> TA01551.complete
CCCCTTTTCTTTTTGCTGCGCTTCCGGAGAAGTCGTCTTTGCTAGAAGCC
ACGTGCTAAATTTGTAGCTTGCAAGTTTCGTTCGATTCTTAAACCGTTCG
CCACGAGAGATGACGAAGGGTACCTCCAGCTTTGGTAAGCGCCACAATAA
GACGCACACCCTGTGCCGTCGCTGTGGCCGCTCCTCCTACCACATCCAGA
AGTCCACTTGCGCCCAGTGCGGCTACCCCGCCGCCAAGTTGCGTTCCTAC
AACTGGTCCGTGAAGGCCAAGAGGAGGAAGACCACCGGCACCGGTCGCAT
GCAGCACCTGAAGGTTGTGCGCCGCCGTTTCCGCAACGGATTCCGCGAGG
GCACCCAGGCCAAGCCCAAGAAGGCCGTGGCCAGCAAGTAGGAGGCTCTG
TGTGTCCCAAGATGTATATCCCACACCGGGCTATATGGACGGAGATAGCA
GCTGCTCCCTTAACCGCAGATAACGACAGCCTCCAGTTGATCAACGTGTA
CACACCATCTAAAATCCACTGAAAATGGCCCCTCAACATGGCTAATAAAT
CGCTCGAGCGCGAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

TA01551.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:02:46
Subject Length Description Subject Range Query Range Score Percent Strand
RpL37a-RA 1226 RpL37a-RA 55..621 2..568 2805 99.6 Plus
RpL37b-RA 403 RpL37b-RA 85..248 108..271 250 76.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:21:18
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 15028750..15029062 561..249 1565 100 Minus
chrX 22417052 chrX 15029128..15029264 248..112 685 100 Minus
chrX 22417052 chrX 15029401..15029511 112..2 555 100 Minus
chr2R 21145070 chr2R 18986598..18986832 342..108 245 73.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:59:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:21:17
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15138594..15138913 568..249 1570 99.4 Minus
X 23542271 X 15138979..15139115 248..112 685 100 Minus
X 23542271 X 15139252..15139362 112..2 555 100 Minus
2R 25286936 2R 23100141..23100375 342..108 275 74.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:58:02
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 15146692..15147011 568..249 1570 99.3 Minus
X 23527363 X 15147077..15147213 248..112 685 100 Minus
X 23527363 X 15147350..15147460 112..2 555 100 Minus
2R 25260384 2R 23101411..23101574 271..108 250 76.8 Minus
Blast to na_te.dros performed on 2019-03-15 18:21:17 has no hits.

TA01551.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:22:13 Download gff for TA01551.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 15028749..15029062 249..562 99 <- Minus
chrX 15029128..15029263 113..248 100 <- Minus
chrX 15029401..15029511 1..112 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:11:46 Download gff for TA01551.complete
Subject Subject Range Query Range Percent Splice Strand
RpL37a-RA 1..282 110..391 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:00:17 Download gff for TA01551.complete
Subject Subject Range Query Range Percent Splice Strand
RpL37a-RA 1..282 110..391 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:59:55 Download gff for TA01551.complete
Subject Subject Range Query Range Percent Splice Strand
RpL37a-RA 1..282 110..391 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:59:49 Download gff for TA01551.complete
Subject Subject Range Query Range Percent Splice Strand
RpL37a-RA 1..282 110..391 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:59:05 Download gff for TA01551.complete
Subject Subject Range Query Range Percent Splice Strand
RpL37a-RA 1..282 110..391 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:25:30 Download gff for TA01551.complete
Subject Subject Range Query Range Percent Splice Strand
RpL37a-RA 28..588 1..562 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:00:17 Download gff for TA01551.complete
Subject Subject Range Query Range Percent Splice Strand
RpL37a-RA 28..588 1..562 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:59:55 Download gff for TA01551.complete
Subject Subject Range Query Range Percent Splice Strand
RpL37a-RA 5..565 1..562 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:59:50 Download gff for TA01551.complete
Subject Subject Range Query Range Percent Splice Strand
RpL37a-RA 28..588 1..562 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:59:05 Download gff for TA01551.complete
Subject Subject Range Query Range Percent Splice Strand
RpL37a-RA 5..565 1..562 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:22:13 Download gff for TA01551.complete
Subject Subject Range Query Range Percent Splice Strand
X 15138600..15138913 249..562 99 <- Minus
X 15138979..15139114 113..248 100 <- Minus
X 15139252..15139362 1..112 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:22:13 Download gff for TA01551.complete
Subject Subject Range Query Range Percent Splice Strand
X 15138600..15138913 249..562 99 <- Minus
X 15138979..15139114 113..248 100 <- Minus
X 15139252..15139362 1..112 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:22:13 Download gff for TA01551.complete
Subject Subject Range Query Range Percent Splice Strand
X 15138600..15138913 249..562 99 <- Minus
X 15138979..15139114 113..248 100 <- Minus
X 15139252..15139362 1..112 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:59:55 Download gff for TA01551.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 15033285..15033395 1..112 99   Minus
arm_X 15032633..15032946 249..562 99 <- Minus
arm_X 15033012..15033147 113..248 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:35:45 Download gff for TA01551.complete
Subject Subject Range Query Range Percent Splice Strand
X 15146698..15147011 249..562 99 <- Minus
X 15147077..15147212 113..248 100 <- Minus
X 15147350..15147460 1..112 99   Minus

TA01551.hyp Sequence

Translation from 109 to 390

> TA01551.hyp
MTKGTSSFGKRHNKTHTLCRRCGRSSYHIQKSTCAQCGYPAAKLRSYNWS
VKAKRRKTTGTGRMQHLKVVRRRFRNGFREGTQAKPKKAVASK*

TA01551.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:57:51
Subject Length Description Subject Range Query Range Score Percent Strand
RpL37a-PB 93 CG9091-PB 1..93 1..93 500 100 Plus
RpL37a-PA 93 CG9091-PA 1..93 1..93 500 100 Plus
RpL37b-PA 89 CG9873-PA 1..87 1..87 372 77 Plus

TA01551.pep Sequence

Translation from 109 to 390

> TA01551.pep
MTKGTSSFGKRHNKTHTLCRRCGRSSYHIQKSTCAQCGYPAAKLRSYNWS
VKAKRRKTTGTGRMQHLKVVRRRFRNGFREGTQAKPKKAVASK*

TA01551.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 06:43:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21054-PA 105 GF21054-PA 13..103 2..92 449 94.5 Plus
Dana\GF13322-PA 90 GF13322-PA 1..89 1..89 324 71.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:43:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19417-PA 94 GG19417-PA 1..92 1..92 467 97.8 Plus
Dere\GG20067-PA 89 GG20067-PA 1..81 1..81 341 79 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 06:43:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24309-PA 106 GH24309-PA 15..106 2..93 461 97.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:26:32
Subject Length Description Subject Range Query Range Score Percent Strand
RpL37a-PB 93 CG9091-PB 1..93 1..93 500 100 Plus
RpL37a-PA 93 CG9091-PA 1..93 1..93 500 100 Plus
RpL37b-PA 89 CG9873-PA 1..87 1..87 372 77 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 06:43:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21554-PA 105 GI21554-PA 14..105 2..93 447 94.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 06:43:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13157-PA 64 GL13157-PA 1..62 31..92 287 91.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 06:43:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12004-PA 94 GM12004-PA 1..92 1..92 467 97.8 Plus
Dsec\GM15582-PA 89 GM15582-PA 1..85 1..85 344 77.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 06:43:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15698-PA 96 GJ15698-PA 5..96 2..93 452 95.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 06:43:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16414-PA 94 GK16414-PA 1..90 1..90 451 95.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:43:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16068-PA 94 GE16068-PA 1..92 1..92 467 97.8 Plus
Dyak\GE11606-PA 89 GE11606-PA 1..87 1..87 346 74.7 Plus