Clone TA01751 Report

Search the DGRC for TA01751

Clone and Library Details

Library:TA
Tissue Source:D melanogaster total adult RNA
Created by: 
Date Registered:2007-04-30
Comments: 
Original Plate Number:17
Well:51
Vector:pOTB7_DraIII
Associated Gene/TranscriptCG15418-RA
Protein status:TA01751.pep: gold
Sequenced Size:508

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15418 2008-04-29 Release 5.5 accounting
CG15418 2008-08-15 Release 5.9 accounting
CG15418 2008-12-18 5.12 accounting

Clone Sequence Records

TA01751.complete Sequence

508 bp assembled on 2007-09-19

GenBank Submission: BT031046

> TA01751.complete
ATTCTGTCACTGACGTTAGTGCAGATCGCAACGGAAAACTGAAGCTCTGC
AATTGGAGTACGAAAGTGCAACTAGAGGATCGATTGGATATATAATTTAT
TTCGCAACTTAGAGAGATTGCCGCCATATGTTAATGAACTGAACAAAATG
GTTTGGATTTCGAGCTGGGGGCAACTTTGGCTGGTGTTGCTATTGGTTGT
GGGCCTATCGTTGGGTCTTCCGAGCTTGGAAAACCAGACACACGAACAAA
TCGAACAGATAATAGCCTGCAGACAGCCAAAGGCACCTGGTTTGTGCCGG
GGTCACCAGTTGCGATATGCCTACAACAAGAAGACCGGAAACTGCGAGAG
CTTCATCTACACGGGCTGTGCCTCCACTGAGAACAATTTCCTGACCTTCG
AGGAGTGTCGCAGGGATTGCATGCAACGTCTGCGCTACTGAAGTCGCTTT
TAACGATGCTTAATATATATATTTGTTGTCAAAAAAAAAAAAAAAAAAAA
AAAAAAAA

TA01751.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:37:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG15418-RA 528 CG15418-RA 29..509 1..481 2405 100 Plus
Dot-RA 2312 Dot-RA 1826..2043 481..264 1090 100 Minus
Dot.a 2554 Dot.a 2090..2307 481..264 1090 100 Minus
Dot-RA 2312 Dot-RA 2106..2312 265..59 1035 100 Minus
Dot.a 2554 Dot.a 2370..2554 265..81 925 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:02:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 3620896..3621160 265..1 1325 100 Minus
chr2L 23010047 chr2L 3620617..3620833 480..264 1085 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:59:43 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:02:53
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3621389..3621653 265..1 1325 100 Minus
2L 23513712 2L 3621109..3621326 481..264 1090 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:29:35
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3621389..3621653 265..1 1325 100 Minus
2L 23513712 2L 3621109..3621326 481..264 1090 100 Minus
Blast to na_te.dros performed on 2019-03-16 15:02:53 has no hits.

TA01751.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:03:37 Download gff for TA01751.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 3620617..3620831 266..480 100 <- Minus
chr2L 3620896..3621160 1..265 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:11:48 Download gff for TA01751.complete
Subject Subject Range Query Range Percent Splice Strand
CG15418-RA 1..294 148..441 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:02:11 Download gff for TA01751.complete
Subject Subject Range Query Range Percent Splice Strand
CG15418-RA 1..294 148..441 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:32:28 Download gff for TA01751.complete
Subject Subject Range Query Range Percent Splice Strand
CG15418-RA 1..294 148..441 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:53:47 Download gff for TA01751.complete
Subject Subject Range Query Range Percent Splice Strand
CG15418-RA 1..294 148..441 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:40:15 Download gff for TA01751.complete
Subject Subject Range Query Range Percent Splice Strand
CG15418-RA 1..294 148..441 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:04:31 Download gff for TA01751.complete
Subject Subject Range Query Range Percent Splice Strand
CG15418-RA 29..508 1..480 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:02:11 Download gff for TA01751.complete
Subject Subject Range Query Range Percent Splice Strand
CG15418-RA 29..508 1..480 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:32:28 Download gff for TA01751.complete
Subject Subject Range Query Range Percent Splice Strand
CG15418-RA 29..508 1..480 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:53:47 Download gff for TA01751.complete
Subject Subject Range Query Range Percent Splice Strand
CG15418-RA 29..508 1..480 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:40:15 Download gff for TA01751.complete
Subject Subject Range Query Range Percent Splice Strand
CG15418-RA 29..508 1..480 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:03:37 Download gff for TA01751.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3621110..3621324 266..480 100 <- Minus
2L 3621389..3621653 1..265 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:03:37 Download gff for TA01751.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3621110..3621324 266..480 100 <- Minus
2L 3621389..3621653 1..265 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:03:37 Download gff for TA01751.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3621110..3621324 266..480 100 <- Minus
2L 3621389..3621653 1..265 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:32:28 Download gff for TA01751.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3621110..3621324 266..480 100 <- Minus
arm_2L 3621389..3621653 1..265 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:54:09 Download gff for TA01751.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3621110..3621324 266..480 100 <- Minus
2L 3621389..3621653 1..265 100   Minus

TA01751.pep Sequence

Translation from 147 to 440

> TA01751.pep
MVWISSWGQLWLVLLLVVGLSLGLPSLENQTHEQIEQIIACRQPKAPGLC
RGHQLRYAYNKKTGNCESFIYTGCASTENNFLTFEECRRDCMQRLRY*

TA01751.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:31:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14660-PA 97 GF14660-PA 1..97 1..97 402 77.3 Plus
Dana\GF14653-PA 137 GF14653-PA 42..110 30..94 135 40.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:31:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24422-PA 97 GG24422-PA 1..97 1..97 400 91.8 Plus
Dere\GG24408-PA 132 GG24408-PA 8..108 6..94 141 32.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:31:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13188-PA 94 GH13188-PA 25..94 28..97 340 87.1 Plus
Dgri\GH13178-PA 135 GH13178-PA 53..106 41..94 138 48.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:18:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG15418-PB 97 CG15418-PB 1..97 1..97 531 100 Plus
CG15418-PA 97 CG15418-PA 1..97 1..97 531 100 Plus
CG3604-PB 132 CG3604-PB 55..106 41..92 144 48.1 Plus
CG3604-PA 132 CG3604-PA 55..106 41..92 144 48.1 Plus
CG2816-PB 84 CG2816-PB 9..81 16..91 134 38.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:31:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17765-PA 95 GI17765-PA 1..95 1..97 332 70.1 Plus
Dmoj\GI10885-PA 81 GI10885-PA 5..81 6..86 224 56.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:31:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19467-PA 96 GL19467-PA 25..96 26..97 344 84.7 Plus
Dper\GL19458-PA 129 GL19458-PA 15..101 15..94 135 37.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:31:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13713-PA 96 GA13713-PA 25..96 26..97 347 84.7 Plus
Dpse\GA30051-PA 93 GA30051-PA 4..85 12..93 144 39 Plus
Dpse\GA17552-PA 129 GA17552-PA 1..101 1..94 137 34.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:31:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18133-PA 97 GM18133-PA 1..97 1..97 491 95.9 Plus
Dsec\GM18125-PA 130 GM18125-PA 1..106 1..94 142 33 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:31:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22741-PA 97 GD22741-PA 1..97 1..97 494 96.9 Plus
Dsim\GD22733-PA 130 GD22733-PA 1..106 1..94 142 33 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:31:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17590-PA 95 GJ17590-PA 25..95 27..97 331 83.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:31:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15474-PA 97 GK15474-PA 1..97 2..97 346 68 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:31:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14827-PA 97 GE14827-PA 1..97 1..97 398 91.8 Plus
Dyak\GE14811-PA 130 GE14811-PA 8..108 6..94 144 33.7 Plus

TA01751.hyp Sequence

Translation from 147 to 440

> TA01751.hyp
MVWISSWGQLWLVLLLVVGLSLGLPSLENQTHEQIEQIIACRQPKAPGLC
RGHQLRYAYNKKTGNCESFIYTGCASTENNFLTFEECRRDCMQRLRY*

TA01751.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:19:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG15418-PA 97 CG15418-PA 1..97 1..97 531 100 Plus
CG3604-PB 132 CG3604-PB 55..106 41..92 144 48.1 Plus
CG3604-PA 132 CG3604-PA 55..106 41..92 144 48.1 Plus
CG2816-PB 84 CG2816-PB 9..81 16..91 134 38.2 Plus