TA01809.complete Sequence
302 bp assembled on 2007-11-15
GenBank Submission: BT031308
> TA01809.complete
ATCAGCGTAAAATTCGGAAAACCCAGCGATCTAGTTATGAAATACTTTGT
GGTCCTTGTCGTCCTGGCCCTCATTTTGGCCATCAGCGTGGGTCCTTCGG
ATGCAGTATTTATTGATATTCTTGACAAAGTGGAAAACGCAATACACAAT
GCTGCTCAAGTGGGAATTGGCTTTGCTAAGCCCTTTGAAAAATTGATCAA
TCCGAAGTAATTCTGCACTGCAATTTAATTAATGTATCGTTTAACGAAAA
TAAACACAAATTTTAAAATCCAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AA
TA01809.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 16:37:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Anp-RA | 412 | Anp-RA | 15..291 | 1..277 | 1340 | 98.9 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 13:15:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 26032401..26032533 | 1..133 | 650 | 99.2 | Plus |
chr3R | 27901430 | chr3R | 26032594..26032746 | 132..270 | 520 | 90.8 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:59:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 13:15:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 30210142..30210287 | 132..277 | 700 | 98.6 | Plus |
3R | 32079331 | 3R | 30209949..30210081 | 1..133 | 650 | 99.2 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:34:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 29950973..29951118 | 132..277 | 700 | 98.6 | Plus |
3R | 31820162 | 3R | 29950780..29950912 | 1..133 | 650 | 99.2 | Plus |
Blast to na_te.dros performed on 2019-03-15 13:15:32 has no hits.
TA01809.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 13:16:27 Download gff for
TA01809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 26032401..26032532 | 1..132 | 99 | -> | Plus |
chr3R | 26032595..26032683 | 133..218 | 93 | <- | Plus |
chr3R | 26032695..26032746 | 219..271 | 98 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:11:50 Download gff for
TA01809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Anp-RA | 1..174 | 37..210 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:07:36 Download gff for
TA01809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Anp-RA | 1..174 | 37..210 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 22:00:03 Download gff for
TA01809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Anp-RA | 1..174 | 37..210 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:53:49 Download gff for
TA01809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Anp-RA | 1..174 | 37..210 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:26:19 Download gff for
TA01809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Anp-RA | 1..174 | 37..210 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:04:35 Download gff for
TA01809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Anp-RA | 2..271 | 1..271 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:07:36 Download gff for
TA01809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Anp-RA | 2..271 | 1..271 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 22:00:03 Download gff for
TA01809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Anp-RA | 2..271 | 1..271 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:53:49 Download gff for
TA01809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Anp-RA | 2..271 | 1..271 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:26:19 Download gff for
TA01809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Anp-RA | 2..271 | 1..271 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:16:27 Download gff for
TA01809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 30209949..30210080 | 1..132 | 99 | -> | Plus |
3R | 30210143..30210280 | 133..271 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:16:27 Download gff for
TA01809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 30209949..30210080 | 1..132 | 99 | -> | Plus |
3R | 30210143..30210280 | 133..271 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:16:27 Download gff for
TA01809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 30209949..30210080 | 1..132 | 99 | -> | Plus |
3R | 30210143..30210280 | 133..271 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 22:00:03 Download gff for
TA01809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 26035671..26035802 | 1..132 | 99 | -> | Plus |
arm_3R | 26035865..26036002 | 133..271 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:59:52 Download gff for
TA01809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 29950780..29950911 | 1..132 | 99 | -> | Plus |
3R | 29950974..29951111 | 133..271 | 99 | | Plus |
TA01809.hyp Sequence
Translation from 0 to 209
> TA01809.hyp
ISVKFGKPSDLVMKYFVVLVVLALILAISVGPSDAVFIDILDKVENAIHN
AAQVGIGFAKPFEKLINPK*
TA01809.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:46:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Anp-PB | 57 | CG1361-PB | 1..57 | 13..69 | 279 | 100 | Plus |
Anp-PA | 57 | CG1361-PA | 1..57 | 13..69 | 279 | 100 | Plus |
TA01809.pep Sequence
Translation from 36 to 209
> TA01809.pep
MKYFVVLVVLALILAISVGPSDAVFIDILDKVENAIHNAAQVGIGFAKPF
EKLINPK*
TA01809.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:33:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG11738-PA | 66 | GG11738-PA | 1..57 | 1..57 | 166 | 70.2 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:35:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Anp-PB | 57 | CG1361-PB | 1..57 | 1..57 | 279 | 100 | Plus |
Anp-PA | 57 | CG1361-PA | 1..57 | 1..57 | 279 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:33:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\Anp-PA | 57 | GM12868-PA | 1..57 | 1..57 | 172 | 82.5 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:33:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\Anp-PA | 57 | GE10865-PA | 1..57 | 1..57 | 194 | 68.4 | Plus |