Clone TA01809 Report

Search the DGRC for TA01809

Clone and Library Details

Library:TA
Tissue Source:D melanogaster total adult RNA
Created by: 
Date Registered:2007-04-30
Comments: 
Original Plate Number:18
Well:9
Vector:pOTB7_DraIII
Associated Gene/TranscriptAnp-RA
Protein status:TA01809.pep: gold
Sequenced Size:302

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Anp 2008-04-29 Release 5.5 accounting
Anp 2008-08-15 Release 5.9 accounting
Anp 2008-12-18 5.12 accounting

Clone Sequence Records

TA01809.complete Sequence

302 bp assembled on 2007-11-15

GenBank Submission: BT031308

> TA01809.complete
ATCAGCGTAAAATTCGGAAAACCCAGCGATCTAGTTATGAAATACTTTGT
GGTCCTTGTCGTCCTGGCCCTCATTTTGGCCATCAGCGTGGGTCCTTCGG
ATGCAGTATTTATTGATATTCTTGACAAAGTGGAAAACGCAATACACAAT
GCTGCTCAAGTGGGAATTGGCTTTGCTAAGCCCTTTGAAAAATTGATCAA
TCCGAAGTAATTCTGCACTGCAATTTAATTAATGTATCGTTTAACGAAAA
TAAACACAAATTTTAAAATCCAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AA

TA01809.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:37:09
Subject Length Description Subject Range Query Range Score Percent Strand
Anp-RA 412 Anp-RA 15..291 1..277 1340 98.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 13:15:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 26032401..26032533 1..133 650 99.2 Plus
chr3R 27901430 chr3R 26032594..26032746 132..270 520 90.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:59:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 13:15:31
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30210142..30210287 132..277 700 98.6 Plus
3R 32079331 3R 30209949..30210081 1..133 650 99.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:34:02
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29950973..29951118 132..277 700 98.6 Plus
3R 31820162 3R 29950780..29950912 1..133 650 99.2 Plus
Blast to na_te.dros performed on 2019-03-15 13:15:32 has no hits.

TA01809.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 13:16:27 Download gff for TA01809.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 26032401..26032532 1..132 99 -> Plus
chr3R 26032595..26032683 133..218 93 <- Plus
chr3R 26032695..26032746 219..271 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:11:50 Download gff for TA01809.complete
Subject Subject Range Query Range Percent Splice Strand
Anp-RA 1..174 37..210 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:07:36 Download gff for TA01809.complete
Subject Subject Range Query Range Percent Splice Strand
Anp-RA 1..174 37..210 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 22:00:03 Download gff for TA01809.complete
Subject Subject Range Query Range Percent Splice Strand
Anp-RA 1..174 37..210 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:53:49 Download gff for TA01809.complete
Subject Subject Range Query Range Percent Splice Strand
Anp-RA 1..174 37..210 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:26:19 Download gff for TA01809.complete
Subject Subject Range Query Range Percent Splice Strand
Anp-RA 1..174 37..210 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:04:35 Download gff for TA01809.complete
Subject Subject Range Query Range Percent Splice Strand
Anp-RA 2..271 1..271 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:07:36 Download gff for TA01809.complete
Subject Subject Range Query Range Percent Splice Strand
Anp-RA 2..271 1..271 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 22:00:03 Download gff for TA01809.complete
Subject Subject Range Query Range Percent Splice Strand
Anp-RA 2..271 1..271 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:53:49 Download gff for TA01809.complete
Subject Subject Range Query Range Percent Splice Strand
Anp-RA 2..271 1..271 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:26:19 Download gff for TA01809.complete
Subject Subject Range Query Range Percent Splice Strand
Anp-RA 2..271 1..271 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:16:27 Download gff for TA01809.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30209949..30210080 1..132 99 -> Plus
3R 30210143..30210280 133..271 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:16:27 Download gff for TA01809.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30209949..30210080 1..132 99 -> Plus
3R 30210143..30210280 133..271 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:16:27 Download gff for TA01809.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30209949..30210080 1..132 99 -> Plus
3R 30210143..30210280 133..271 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 22:00:03 Download gff for TA01809.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26035671..26035802 1..132 99 -> Plus
arm_3R 26035865..26036002 133..271 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:59:52 Download gff for TA01809.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29950780..29950911 1..132 99 -> Plus
3R 29950974..29951111 133..271 99   Plus

TA01809.hyp Sequence

Translation from 0 to 209

> TA01809.hyp
ISVKFGKPSDLVMKYFVVLVVLALILAISVGPSDAVFIDILDKVENAIHN
AAQVGIGFAKPFEKLINPK*

TA01809.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:46:11
Subject Length Description Subject Range Query Range Score Percent Strand
Anp-PB 57 CG1361-PB 1..57 13..69 279 100 Plus
Anp-PA 57 CG1361-PA 1..57 13..69 279 100 Plus

TA01809.pep Sequence

Translation from 36 to 209

> TA01809.pep
MKYFVVLVVLALILAISVGPSDAVFIDILDKVENAIHNAAQVGIGFAKPF
EKLINPK*

TA01809.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:33:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11738-PA 66 GG11738-PA 1..57 1..57 166 70.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:35:09
Subject Length Description Subject Range Query Range Score Percent Strand
Anp-PB 57 CG1361-PB 1..57 1..57 279 100 Plus
Anp-PA 57 CG1361-PA 1..57 1..57 279 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:33:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\Anp-PA 57 GM12868-PA 1..57 1..57 172 82.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:33:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Anp-PA 57 GE10865-PA 1..57 1..57 194 68.4 Plus