Clone TD01073 Report

Search the DGRC for TD01073

Clone and Library Details

Library:TD
Tissue Source:D. melanogaster mixed adult, total RNA (Bloomington)
Created by:
Date Registered:2010-07-20
Comments:
Original Plate Number:10
Well:73
Vector:pOTB7_DraIIIS
Associated Gene/TranscriptmRpL34-RA
Protein status:TD01073.pep: gold
Sequenced Size:336

Clone Sequence Records

TD01073.complete Sequence

336 bp assembled on 2011-03-07

GenBank Submission: BT126121.1

> TD01073.complete
GATACTAACTGGAAATTACTTAACATGCTGCAAGGAATGCTCCAAAGGAC
CTGCCTGGCGGTTGTCAGCACCGCACAAACTCTAATCGTGCGGGATAAGC
ACGCTTTCAACCGGGCGGTGCTGAAACCGAAAGTACGCTGCCATTTTCCG
AAACCCATGGAGGTGAAGAGAATTAATGTCCACGGCTGGAATGCTAGGAT
GTCGACGCCTGAGGGACGACGAGTGCTGATGAACCGGATCCTCAAAGGAC
GTCACAATTTGTCACACTAGCCTTGTGTTAATAAACCTAACTTTATTTAC
AATGAGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

TD01073.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:18:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 11986422..11986680 46..304 1295 100 Plus
chr2R 21145070 chr2R 11986315..11986361 2..48 235 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:18:53
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16099077..16099335 46..304 1295 100 Plus
2R 25286936 2R 16098970..16099016 2..48 235 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:08:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16100276..16100534 46..304 1295 100 Plus
2R 25260384 2R 16100169..16100215 2..48 235 100 Plus
Blast to na_te.dros performed on 2019-03-16 22:18:53 has no hits.

TD01073.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:19:37 Download gff for TD01073.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 11986314..11986360 1..47 97 -> Plus
chr2R 11986424..11986680 48..306 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-22 16:00:47 Download gff for TD01073.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL34-RA 1..246 25..270 97   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-07 15:11:31 Download gff for TD01073.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL34-RA 1..246 25..270 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:53:54 Download gff for TD01073.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL34-RA 1..246 25..270 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:26:24 Download gff for TD01073.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL34-RA 1..246 25..270 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-22 16:00:46 Download gff for TD01073.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL34-RA 1..280 25..306 96   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-07 15:11:31 Download gff for TD01073.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL34-RA 1..280 25..306 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:53:54 Download gff for TD01073.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL34-RA 22..325 1..306 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:26:24 Download gff for TD01073.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL34-RA 22..325 1..306 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:19:37 Download gff for TD01073.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16098969..16099015 1..47 97 -> Plus
2R 16099079..16099335 48..306 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:19:37 Download gff for TD01073.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16098969..16099015 1..47 97 -> Plus
2R 16099079..16099335 48..306 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:19:37 Download gff for TD01073.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16098969..16099015 1..47 97 -> Plus
2R 16099079..16099335 48..306 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:53:54 Download gff for TD01073.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11986474..11986520 1..47 97 -> Plus
arm_2R 11986584..11986840 48..306 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:00:44 Download gff for TD01073.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16100278..16100534 48..306 99   Plus
2R 16100168..16100214 1..47 97 -> Plus

TD01073.pep Sequence

Translation from 0 to 269

> TD01073.pep
DTNWKLLNMLQGMLQRTCLAVVSTAQTLIVRDKHAFNRAVLKPKVRCHFP
KPMEVKRINVHGWNARMSTPEGRRVLMNRILKGRHNLSH*

TD01073.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:00:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11289-PA 81 GF11289-PA 1..81 9..89 359 79 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:00:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20565-PA 89 GG20565-PA 17..89 17..89 386 98.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:00:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22066-PA 81 GH22066-PA 1..81 9..89 367 84 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:06:12
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL34-PA 81 CG34147-PA 1..81 9..89 427 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:00:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19150-PA 81 GI19150-PA 1..81 9..89 371 84 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:00:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17214-PA 81 GL17214-PA 1..81 9..89 364 81.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:00:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25044-PA 81 GA25044-PA 1..81 9..89 364 81.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:00:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21656-PA 81 GM21656-PA 1..81 9..89 422 98.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:00:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22285-PA 81 GJ22285-PA 1..81 9..89 362 81.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:00:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11750-PA 81 GE11750-PA 1..81 9..89 414 96.3 Plus

TD01073.hyp Sequence

Translation from 0 to 269

> TD01073.hyp
HTNWKLLNMLQGMLQRTCLAVVSTAQTLIVRDKHAFNRAVLKPKVRCHFP
KPMEVKRINVHGWNARMSTPEGRRVLMNRILKGRHNLSH*

TD01073.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:02:33
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL34-PA 81 CG34147-PA 1..81 9..89 427 100 Plus