BDGP Sequence Production Resources |
Search the DGRC for TD01073
Library: | TD |
Tissue Source: | D. melanogaster mixed adult, total RNA (Bloomington) |
Created by: | |
Date Registered: | 2010-07-20 |
Comments: | |
Original Plate Number: | 10 |
Well: | 73 |
Vector: | pOTB7_DraIIIS |
Associated Gene/Transcript | mRpL34-RA |
Protein status: | TD01073.pep: gold |
Sequenced Size: | 336 |
336 bp assembled on 2011-03-07
GenBank Submission: BT126121.1
> TD01073.complete GATACTAACTGGAAATTACTTAACATGCTGCAAGGAATGCTCCAAAGGAC CTGCCTGGCGGTTGTCAGCACCGCACAAACTCTAATCGTGCGGGATAAGC ACGCTTTCAACCGGGCGGTGCTGAAACCGAAAGTACGCTGCCATTTTCCG AAACCCATGGAGGTGAAGAGAATTAATGTCCACGGCTGGAATGCTAGGAT GTCGACGCCTGAGGGACGACGAGTGCTGATGAACCGGATCCTCAAAGGAC GTCACAATTTGTCACACTAGCCTTGTGTTAATAAACCTAACTTTATTTAC AATGAGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 11986314..11986360 | 1..47 | 97 | -> | Plus |
chr2R | 11986424..11986680 | 48..306 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL34-RA | 1..246 | 25..270 | 97 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL34-RA | 1..246 | 25..270 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL34-RA | 1..246 | 25..270 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL34-RA | 1..246 | 25..270 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL34-RA | 1..280 | 25..306 | 96 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL34-RA | 1..280 | 25..306 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL34-RA | 22..325 | 1..306 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL34-RA | 22..325 | 1..306 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 16098969..16099015 | 1..47 | 97 | -> | Plus |
2R | 16099079..16099335 | 48..306 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 16098969..16099015 | 1..47 | 97 | -> | Plus |
2R | 16099079..16099335 | 48..306 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 16098969..16099015 | 1..47 | 97 | -> | Plus |
2R | 16099079..16099335 | 48..306 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 11986474..11986520 | 1..47 | 97 | -> | Plus |
arm_2R | 11986584..11986840 | 48..306 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 16100278..16100534 | 48..306 | 99 | Plus | |
2R | 16100168..16100214 | 1..47 | 97 | -> | Plus |
Translation from 0 to 269
> TD01073.pep DTNWKLLNMLQGMLQRTCLAVVSTAQTLIVRDKHAFNRAVLKPKVRCHFP KPMEVKRINVHGWNARMSTPEGRRVLMNRILKGRHNLSH*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF11289-PA | 81 | GF11289-PA | 1..81 | 9..89 | 359 | 79 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20565-PA | 89 | GG20565-PA | 17..89 | 17..89 | 386 | 98.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH22066-PA | 81 | GH22066-PA | 1..81 | 9..89 | 367 | 84 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpL34-PA | 81 | CG34147-PA | 1..81 | 9..89 | 427 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI19150-PA | 81 | GI19150-PA | 1..81 | 9..89 | 371 | 84 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17214-PA | 81 | GL17214-PA | 1..81 | 9..89 | 364 | 81.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA25044-PA | 81 | GA25044-PA | 1..81 | 9..89 | 364 | 81.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21656-PA | 81 | GM21656-PA | 1..81 | 9..89 | 422 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ22285-PA | 81 | GJ22285-PA | 1..81 | 9..89 | 362 | 81.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE11750-PA | 81 | GE11750-PA | 1..81 | 9..89 | 414 | 96.3 | Plus |
Translation from 0 to 269
> TD01073.hyp HTNWKLLNMLQGMLQRTCLAVVSTAQTLIVRDKHAFNRAVLKPKVRCHFP KPMEVKRINVHGWNARMSTPEGRRVLMNRILKGRHNLSH*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpL34-PA | 81 | CG34147-PA | 1..81 | 9..89 | 427 | 100 | Plus |