BDGP Sequence Production Resources |
Search the DGRC for UT01503
Library: | UT |
Tissue Source: | Testis |
Created by: | Ling Hong |
Date Registered: | 2002-09-12 |
Comments: | UAS-Unpaired overexpressed in Testes from Fuller lab |
Original Plate Number: | 15 |
Well: | 3 |
Vector: | pOTB7 |
Associated Gene/Transcript | msd1-RA |
Protein status: | UT01503.pep: gold |
Sequenced Size: | 514 |
Gene | Date | Evidence |
---|---|---|
CG13914 | 2003-01-01 | Sim4 clustering to Release 3 |
CG13914 | 2004-01-31 | Blastp of sequenced clone |
CG13914 | 2008-04-29 | Release 5.5 accounting |
CG13914 | 2008-08-15 | Release 5.9 accounting |
CG13914 | 2008-12-18 | 5.12 accounting |
514 bp (514 high quality bases) assembled on 2004-01-31
GenBank Submission: BT011514
> UT01503.complete CGAAATGTCAGACGCTGTGGACAAAATGTTGGCGGGAATGGCGGCCAATC GGCAGACCATGAACCGCCAGCTGGCTAAGATAGACGAGATAATGGAGCGG TCGAACAACACATTGCTCCACATCGAGTCCAACAGCAAGGCATTCAGTCA GAATGTGGCTTTGTCGGAGACCCAGAAGATGTACAACCTCAGGCCGGAGG CTGAGATGACCCTGTCCAAGATCCTGGAGAACTTCAAGCTGCTCATGTCT AGCAGTGACCAGCGGGAGGAGACATACAGCGCTCTGGAGGGCTGCCTGGC CTACAGGCATCGCGTGGAGCACCTTGGCAGCTCCGTGCGTAAGCTGGTGG CGCTCTACGACACCGTGGGCCAGATGAAGAACTCACAGGAAGAGCAGTAT GCCAGCGAGGATTCCCCCTAGCTCATCCATTTTTAGAATTTATTATTATG TTATAGTTGAAAAATAATTTAAATAAATTAAACATTTGATTTGTAAAAAA AAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
msd1-RA | 544 | msd1-RA | 53..544 | 1..492 | 2460 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
gypsy11 | 4428 | gypsy11 GYPSY11 4428bp | 1582..1641 | 491..430 | 124 | 71 | Minus |
gypsy5 | 7369 | gypsy5 GYPSY5 7369bp | 5501..5528 | 455..482 | 113 | 89.3 | Plus |
roo | 9092 | roo DM_ROO 9092bp | 1354..1393 | 459..420 | 110 | 75 | Minus |
Dbuz\ISBu3 | 993 | Dbuz\ISBu3 ISBU3 993bp | 374..439 | 493..430 | 108 | 66.7 | Minus |
Max-element | 8556 | Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). | 1061..1104 | 438..482 | 105 | 73.3 | Plus |
HeT-A | 6083 | HeT-A DM06920 6083bp Derived from U06920.2 (Rel. 67, Last updated, Version 14). | 2..31 | 462..491 | 105 | 83.3 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 1331290..1331330 | 1..41 | 100 | -> | Plus |
chr3L | 1331386..1331772 | 42..428 | 98 | == | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13914-RA | 1..417 | 5..421 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
msd1-RA | 1..417 | 5..421 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
msd1-RA | 1..417 | 5..421 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13914-RA | 1..417 | 5..421 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
msd1-RA | 1..417 | 5..421 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13914-RA | 50..541 | 1..492 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
msd1-RA | 50..541 | 1..492 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
msd1-RA | 35..528 | 1..494 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13914-RA | 50..541 | 1..492 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
msd1-RA | 35..528 | 1..494 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 1331778..1331818 | 1..41 | 100 | -> | Plus |
3L | 1331874..1332326 | 42..494 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 1331778..1331818 | 1..41 | 100 | -> | Plus |
3L | 1331874..1332326 | 42..494 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 1331778..1331818 | 1..41 | 100 | -> | Plus |
3L | 1331874..1332326 | 42..494 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 1331778..1331818 | 1..41 | 100 | -> | Plus |
arm_3L | 1331874..1332326 | 42..494 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 1331874..1332326 | 42..494 | 100 | Plus | |
3L | 1331778..1331818 | 1..41 | 100 | -> | Plus |
Translation from 0 to 420
> UT01503.hyp EMSDAVDKMLAGMAANRQTMNRQLAKIDEIMERSNNTLLHIESNSKAFSQ NVALSETQKMYNLRPEAEMTLSKILENFKLLMSSSDQREETYSALEGCLA YRHRVEHLGSSVRKLVALYDTVGQMKNSQEEQYASEDSP*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
msd1-PA | 138 | CG13914-PA | 1..138 | 2..139 | 685 | 100 | Plus |
Translation from 4 to 420
> UT01503.pep MSDAVDKMLAGMAANRQTMNRQLAKIDEIMERSNNTLLHIESNSKAFSQN VALSETQKMYNLRPEAEMTLSKILENFKLLMSSSDQREETYSALEGCLAY RHRVEHLGSSVRKLVALYDTVGQMKNSQEEQYASEDSP*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24456-PA | 138 | GF24456-PA | 1..137 | 1..137 | 525 | 72.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG14784-PA | 138 | GG14784-PA | 1..138 | 1..138 | 671 | 92.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15217-PA | 150 | GH15217-PA | 1..134 | 1..129 | 276 | 44.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
msd1-PA | 138 | CG13914-PA | 1..138 | 1..138 | 685 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI12036-PA | 151 | GI12036-PA | 1..135 | 1..131 | 261 | 46.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL16181-PA | 140 | GL16181-PA | 1..129 | 1..128 | 384 | 57.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12622-PA | 140 | GA12622-PA | 1..140 | 1..138 | 397 | 57.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM14403-PA | 138 | GM14403-PA | 1..138 | 1..138 | 693 | 95.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD13612-PA | 138 | GD13612-PA | 1..138 | 1..138 | 699 | 95.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12152-PA | 152 | GJ12152-PA | 1..136 | 1..132 | 319 | 47.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK13368-PA | 158 | GK13368-PA | 1..142 | 1..136 | 222 | 40.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE21147-PA | 138 | GE21147-PA | 1..138 | 1..138 | 667 | 92 | Plus |