Clone UT01503 Report

Search the DGRC for UT01503

Clone and Library Details

Library:UT
Tissue Source:Testis
Created by:Ling Hong
Date Registered:2002-09-12
Comments:UAS-Unpaired overexpressed in Testes from Fuller lab
Original Plate Number:15
Well:3
Vector:pOTB7
Associated Gene/Transcriptmsd1-RA
Protein status:UT01503.pep: gold
Sequenced Size:514

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13914 2003-01-01 Sim4 clustering to Release 3
CG13914 2004-01-31 Blastp of sequenced clone
CG13914 2008-04-29 Release 5.5 accounting
CG13914 2008-08-15 Release 5.9 accounting
CG13914 2008-12-18 5.12 accounting

Clone Sequence Records

UT01503.complete Sequence

514 bp (514 high quality bases) assembled on 2004-01-31

GenBank Submission: BT011514

> UT01503.complete
CGAAATGTCAGACGCTGTGGACAAAATGTTGGCGGGAATGGCGGCCAATC
GGCAGACCATGAACCGCCAGCTGGCTAAGATAGACGAGATAATGGAGCGG
TCGAACAACACATTGCTCCACATCGAGTCCAACAGCAAGGCATTCAGTCA
GAATGTGGCTTTGTCGGAGACCCAGAAGATGTACAACCTCAGGCCGGAGG
CTGAGATGACCCTGTCCAAGATCCTGGAGAACTTCAAGCTGCTCATGTCT
AGCAGTGACCAGCGGGAGGAGACATACAGCGCTCTGGAGGGCTGCCTGGC
CTACAGGCATCGCGTGGAGCACCTTGGCAGCTCCGTGCGTAAGCTGGTGG
CGCTCTACGACACCGTGGGCCAGATGAAGAACTCACAGGAAGAGCAGTAT
GCCAGCGAGGATTCCCCCTAGCTCATCCATTTTTAGAATTTATTATTATG
TTATAGTTGAAAAATAATTTAAATAAATTAAACATTTGATTTGTAAAAAA
AAAAAAAAAAAAAA

UT01503.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:05:00
Subject Length Description Subject Range Query Range Score Percent Strand
msd1-RA 544 msd1-RA 53..544 1..492 2460 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:06:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 1331385..1331836 41..494 2130 98.5 Plus
chr3L 24539361 chr3L 1331290..1331330 1..41 205 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:59:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:06:01
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1331873..1332327 41..495 2275 100 Plus
3L 28110227 3L 1331778..1331818 1..41 205 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:52:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 1331873..1332327 41..495 2275 100 Plus
3L 28103327 3L 1331778..1331818 1..41 205 100 Plus
Blast to na_te.dros performed 2019-03-16 10:06:02
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy11 4428 gypsy11 GYPSY11 4428bp 1582..1641 491..430 124 71 Minus
gypsy5 7369 gypsy5 GYPSY5 7369bp 5501..5528 455..482 113 89.3 Plus
roo 9092 roo DM_ROO 9092bp 1354..1393 459..420 110 75 Minus
Dbuz\ISBu3 993 Dbuz\ISBu3 ISBU3 993bp 374..439 493..430 108 66.7 Minus
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 1061..1104 438..482 105 73.3 Plus
HeT-A 6083 HeT-A DM06920 6083bp Derived from U06920.2 (Rel. 67, Last updated, Version 14). 2..31 462..491 105 83.3 Plus

UT01503.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:06:48 Download gff for UT01503.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 1331290..1331330 1..41 100 -> Plus
chr3L 1331386..1331772 42..428 98 == Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:12:08 Download gff for UT01503.complete
Subject Subject Range Query Range Percent Splice Strand
CG13914-RA 1..417 5..421 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:40:25 Download gff for UT01503.complete
Subject Subject Range Query Range Percent Splice Strand
msd1-RA 1..417 5..421 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:12:09 Download gff for UT01503.complete
Subject Subject Range Query Range Percent Splice Strand
msd1-RA 1..417 5..421 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:29:17 Download gff for UT01503.complete
Subject Subject Range Query Range Percent Splice Strand
CG13914-RA 1..417 5..421 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:55:28 Download gff for UT01503.complete
Subject Subject Range Query Range Percent Splice Strand
msd1-RA 1..417 5..421 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:49:23 Download gff for UT01503.complete
Subject Subject Range Query Range Percent Splice Strand
CG13914-RA 50..541 1..492 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:40:25 Download gff for UT01503.complete
Subject Subject Range Query Range Percent Splice Strand
msd1-RA 50..541 1..492 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:12:09 Download gff for UT01503.complete
Subject Subject Range Query Range Percent Splice Strand
msd1-RA 35..528 1..494 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:29:17 Download gff for UT01503.complete
Subject Subject Range Query Range Percent Splice Strand
CG13914-RA 50..541 1..492 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:55:28 Download gff for UT01503.complete
Subject Subject Range Query Range Percent Splice Strand
msd1-RA 35..528 1..494 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:06:48 Download gff for UT01503.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1331778..1331818 1..41 100 -> Plus
3L 1331874..1332326 42..494 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:06:48 Download gff for UT01503.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1331778..1331818 1..41 100 -> Plus
3L 1331874..1332326 42..494 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:06:48 Download gff for UT01503.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1331778..1331818 1..41 100 -> Plus
3L 1331874..1332326 42..494 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:12:09 Download gff for UT01503.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1331778..1331818 1..41 100 -> Plus
arm_3L 1331874..1332326 42..494 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:01:40 Download gff for UT01503.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1331874..1332326 42..494 100   Plus
3L 1331778..1331818 1..41 100 -> Plus

UT01503.hyp Sequence

Translation from 0 to 420

> UT01503.hyp
EMSDAVDKMLAGMAANRQTMNRQLAKIDEIMERSNNTLLHIESNSKAFSQ
NVALSETQKMYNLRPEAEMTLSKILENFKLLMSSSDQREETYSALEGCLA
YRHRVEHLGSSVRKLVALYDTVGQMKNSQEEQYASEDSP*

UT01503.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:33:20
Subject Length Description Subject Range Query Range Score Percent Strand
msd1-PA 138 CG13914-PA 1..138 2..139 685 100 Plus

UT01503.pep Sequence

Translation from 4 to 420

> UT01503.pep
MSDAVDKMLAGMAANRQTMNRQLAKIDEIMERSNNTLLHIESNSKAFSQN
VALSETQKMYNLRPEAEMTLSKILENFKLLMSSSDQREETYSALEGCLAY
RHRVEHLGSSVRKLVALYDTVGQMKNSQEEQYASEDSP*

UT01503.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:45:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24456-PA 138 GF24456-PA 1..137 1..137 525 72.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:45:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14784-PA 138 GG14784-PA 1..138 1..138 671 92.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:45:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15217-PA 150 GH15217-PA 1..134 1..129 276 44.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:13:30
Subject Length Description Subject Range Query Range Score Percent Strand
msd1-PA 138 CG13914-PA 1..138 1..138 685 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:45:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12036-PA 151 GI12036-PA 1..135 1..131 261 46.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:45:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16181-PA 140 GL16181-PA 1..129 1..128 384 57.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:45:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12622-PA 140 GA12622-PA 1..140 1..138 397 57.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:45:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14403-PA 138 GM14403-PA 1..138 1..138 693 95.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:45:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13612-PA 138 GD13612-PA 1..138 1..138 699 95.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:45:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12152-PA 152 GJ12152-PA 1..136 1..132 319 47.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:45:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13368-PA 158 GK13368-PA 1..142 1..136 222 40.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:45:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21147-PA 138 GE21147-PA 1..138 1..138 667 92 Plus