Clone UT01871 Report

Search the DGRC for UT01871

Clone and Library Details

Library:UT
Tissue Source:Testis
Created by:Ling Hong
Date Registered:2002-09-12
Comments:UAS-Unpaired overexpressed in Testes from Fuller lab
Original Plate Number:18
Well:71
Vector:pOTB7
Associated Gene/TranscriptCG14451-RA
Protein status:UT01871.pep: gold
Sequenced Size:882

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14451 2003-01-01 Sim4 clustering to Release 3
CG14451 2004-01-31 Blastp of sequenced clone
CG14451 2008-04-29 Release 5.5 accounting
CG14451 2008-08-15 Release 5.9 accounting
CG14451 2008-12-18 5.12 accounting

Clone Sequence Records

UT01871.complete Sequence

882 bp (882 high quality bases) assembled on 2004-01-31

GenBank Submission: BT011512

> UT01871.complete
CTCGGCGCCATATCAGATAAGTTTTACTATGGAAATAGGAGAGCGTGGAA
ATGGAGAACAGGAGGTGCACCGTCGTTGCCGTGGGTGACCTTGTGGATGA
GCTTGGCTTCTGTTGCGAGTGGTGTGGCAAGGTGTACAAGAGTCTTGTCC
GCTACCACAACCACATTGTATGCACCCACAAGTTACCTGTTCCGGATCAC
CAGTTGGTCAACTGCTTCCACTGTCCACGCAGCGATTGCAGATTCCACAA
GCATGGACCCGGAGTACAGAATTTTCGGCAAATTGGAAGGCTCCGCCGCC
ACTACCAGGAGAAGCACATGACAGGACACCTTACGTGCGAGTACTGCCAG
AAGCAGTTTCAACTGAAGTCAGCGCTGGTGGCCCACAGATGTCGGCTGAG
GCATCCAGCCATCAGGGATAGTCAGTCCGCCATCACTTTGGGGAGGCATG
TGTGCAAAAAAGGCTACACGCATCTGGGCGCCCTACAACGGCGCCTCACC
TGCTGCCAGCATGGAACACCAAATACTCCGACGGAGGACCAGAAGGATAT
AAGGGACACGGTGTGTCTGCAATGCAACAAGGAATATGTTGACACCCATC
GCTGTTGTGTACGAACCGAGCGAAGCTTTCAGTCTGACCGTCTCATCTTC
AGAAAGTCTAGTCAGGAGACCCACGGTAAATCCAGGTACCTGCAGGCGGA
AGACTGGCGCTTTCTGTTTGAAATGGAGCAGCTTGTCCGCGGCATTGACG
ACGGGCTTGTGCGGGACCCTTTGTTGCTCACGGAACTCGCCTCTCTGGTG
CCGGTGCTTCAGCAAATCCAGGATTCTGATTTAGAAATAAAGTGACATTA
TTTGTAACGACCAAAAAAAAAAAAAAAAAAAA

UT01871.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:05:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG14451-RA 795 CG14451-RA 1..795 51..845 3975 100 Plus
mael.d 1940 mael.d 1..69 255..187 345 100 Minus
mael.e 1940 mael.e 1..69 758..690 345 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:55:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 22710133..22710994 862..1 4310 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 22:00:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:55:19
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 22721227..22722091 865..1 4325 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:52:27
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 22714327..22715191 865..1 4325 100 Minus
Blast to na_te.dros performed on 2019-03-16 19:55:19 has no hits.

UT01871.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:56:29 Download gff for UT01871.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 22710133..22710994 1..862 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:12:11 Download gff for UT01871.complete
Subject Subject Range Query Range Percent Splice Strand
CG14451-RA 1..795 51..845 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:40:28 Download gff for UT01871.complete
Subject Subject Range Query Range Percent Splice Strand
CG14451-RA 1..795 51..845 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:00:49 Download gff for UT01871.complete
Subject Subject Range Query Range Percent Splice Strand
CG14451-RA 1..795 51..845 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:29:19 Download gff for UT01871.complete
Subject Subject Range Query Range Percent Splice Strand
CG14451-RA 1..795 51..845 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:45:34 Download gff for UT01871.complete
Subject Subject Range Query Range Percent Splice Strand
CG14451-RA 1..795 51..845 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:49:26 Download gff for UT01871.complete
Subject Subject Range Query Range Percent Splice Strand
CG14451-RA 1..795 51..845 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:40:28 Download gff for UT01871.complete
Subject Subject Range Query Range Percent Splice Strand
CG14451-RA 1..862 1..862 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:00:49 Download gff for UT01871.complete
Subject Subject Range Query Range Percent Splice Strand
CG14451-RA 1..862 1..862 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:29:19 Download gff for UT01871.complete
Subject Subject Range Query Range Percent Splice Strand
CG14451-RA 1..795 51..845 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:45:34 Download gff for UT01871.complete
Subject Subject Range Query Range Percent Splice Strand
CG14451-RA 1..862 1..862 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:56:29 Download gff for UT01871.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22721230..22722091 1..862 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:56:29 Download gff for UT01871.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22721230..22722091 1..862 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:56:29 Download gff for UT01871.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22721230..22722091 1..862 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:00:49 Download gff for UT01871.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 22714330..22715191 1..862 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:01:42 Download gff for UT01871.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22714330..22715191 1..862 100   Minus

UT01871.pep Sequence

Translation from 50 to 844

> UT01871.pep
MENRRCTVVAVGDLVDELGFCCEWCGKVYKSLVRYHNHIVCTHKLPVPDH
QLVNCFHCPRSDCRFHKHGPGVQNFRQIGRLRRHYQEKHMTGHLTCEYCQ
KQFQLKSALVAHRCRLRHPAIRDSQSAITLGRHVCKKGYTHLGALQRRLT
CCQHGTPNTPTEDQKDIRDTVCLQCNKEYVDTHRCCVRTERSFQSDRLIF
RKSSQETHGKSRYLQAEDWRFLFEMEQLVRGIDDGLVRDPLLLTELASLV
PVLQQIQDSDLEIK*

UT01871.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:43:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13173-PA 257 GG13173-PA 1..257 1..264 888 68.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:15:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG14451-PA 264 CG14451-PA 1..264 1..264 1457 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:43:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11512-PA 245 GI11512-PA 15..244 11..257 196 24.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:43:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11673-PA 202 GL11673-PA 13..193 81..259 149 27.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:43:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24232-PA 295 GA24232-PA 10..286 3..259 244 26.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:43:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22083-PA 256 GM22083-PA 1..256 1..264 1144 82.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:43:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12058-PA 252 GD12058-PA 1..252 1..264 1112 81.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:43:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19494-PA 269 GE19494-PA 1..269 1..264 924 71 Plus

UT01871.hyp Sequence

Translation from 50 to 844

> UT01871.hyp
MENRRCTVVAVGDLVDELGFCCEWCGKVYKSLVRYHNHIVCTHKLPVPDH
QLVNCFHCPRSDCRFHKHGPGVQNFRQIGRLRRHYQEKHMTGHLTCEYCQ
KQFQLKSALVAHRCRLRHPAIRDSQSAITLGRHVCKKGYTHLGALQRRLT
CCQHGTPNTPTEDQKDIRDTVCLQCNKEYVDTHRCCVRTERSFQSDRLIF
RKSSQETHGKSRYLQAEDWRFLFEMEQLVRGIDDGLVRDPLLLTELASLV
PVLQQIQDSDLEIK*

UT01871.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:40:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG14451-PA 264 CG14451-PA 1..264 1..264 1457 100 Plus