Clone BO07925 Report

Search the DGRC for BO07925

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:79
Well:25
Vector:pDNR-Dual
Associated Gene/Transcriptl(2)05510-RA
Protein status:BO07925.pep: validated full length
Sequenced Size:1276

Clone Sequence Records

BO07925.3prime Sequence

949 bp (832 high quality bases) assembled on 2006-01-06

> BO07925.3prime
ATGGTCTAGAAAGCTTGCCATCAGCCGCCAACTCCATGCCCCCAGAATCG
TCCAGAGAGCCAGCGACAGGCCGTTCGATGCGGCTCCCGATCCGGCACTG
AGATGTCCCAGCTCCCGCTCGTCCACGACAAAGGCGGGCTGAGCACTGGC
GGGCGTCTGCTCCATGGCAAAGTTGCCGCGACTATTCCTGGCCAAGCGCT
GGTTGGCCAGCTTCAGCTCCCTAAGCTTCTCCTCCAGCTGCAGGACCTCA
TTCTTGTTGACACCCTCGATATCCTGAACCTGCAGGAACATGGCCAGCGA
GATCTCGTAGACCTTGTTCGCTGAGCTGATCTCTCGCTTGCGTCGACCGA
AGCCCACCTGGTTGTTGGAGCACTGGGTGCCGAGGCACTTGTCCAAACAC
ACGTTGACCGTGGCACGGAATTGCACGTACGACGAGTCGGGGAACTTGAA
GGCCTTGAACTTGGCACTCAAAATGTCGCCATCAATGGTGTTGAAGTTCT
CGAAGAGATAGGGATCCACTGTGCAGCCCTTGAAGATCAACGTTTCCGAT
GACGTATGCGTATCCGTCACATCCAAATAGTTGACACCCAGACCATAAAC
AGGTGCAGAGTCCTCATCCAGATTGATTTCCATTGTCAAAGGTGTGCCCG
ACTTGACAGTCAAATCCCTGGTGAACTTCTGACCATCCTGGCTAACGCCA
ATTGAGAGTCGTGGCTCCGGGGCCCGCTTGGTCAGCGATGTGGTGATCTC
CAGATCCTCGGGTTCCTGGAATCCCGCCGGCAGCACATCCCGCTTGACCA
GGCCGTGGATGCCGCCGCTGGAAGTGGACGTGGAACTGGACCCGGTGGTG
GCATTCATCATCACATTATAGGCGGGACTGGCGGTGGTGATGCACTTAAC
GCTGACGATCTCCTTGCCGCTGGGTGACTCGATGATGATTTTATGGTAT

BO07925.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:13:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG13432-PA 1245 l(2)05510-RA 313..1242 948..19 4625 99.8 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 17:46:35
Subject Length Description Subject Range Query Range Score Percent Strand
qsm-RB 1956 CG13432-RB 573..1502 948..19 4635 99.9 Minus
qsm-RA 1817 CG13432-RA 434..1363 948..19 4635 99.9 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 17:46:24
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20563789..20564069 247..527 1390 99.6 Plus
2R 25286936 2R 20563488..20563720 19..251 1165 100 Plus
2R 25286936 2R 20565000..20565191 757..948 945 99.5 Plus
2R 25286936 2R 20564130..20564252 527..649 615 100 Plus
2R 25286936 2R 20564322..20564431 648..757 550 100 Plus
Blast to na_te.dros performed on 2015-02-11 17:46:30 has no hits.

BO07925.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:32:45 Download gff for BO07925.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13432-PA 311..1245 18..949 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:20:56 Download gff for BO07925.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13432-PA 311..1245 18..949 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-25 19:45:12 Download gff for BO07925.3prime
Subject Subject Range Query Range Percent Splice Strand
qsm-RA 432..1371 11..949 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 19:32:23 Download gff for BO07925.3prime
Subject Subject Range Query Range Percent Splice Strand
qsm-RA 432..1371 11..949 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 19:32:23 Download gff for BO07925.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 20565001..20565191 758..949 98   Plus
2R 20564323..20564431 649..757 100 <- Plus
2R 20564130..20564251 527..648 100 <- Plus
2R 20563794..20564068 252..526 100 <- Plus
2R 20563480..20563720 11..251 98 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-25 19:45:12 Download gff for BO07925.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16452506..16452696 758..949 98   Plus
arm_2R 16451828..16451936 649..757 100 <- Plus
arm_2R 16451635..16451756 527..648 100 <- Plus
arm_2R 16451299..16451573 252..526 100 <- Plus
arm_2R 16450985..16451225 11..251 98 <- Plus

BO07925.5prime Sequence

957 bp (801 high quality bases) assembled on 2006-01-06

> BO07925.5prime
GAAGTTATCAGTCGACATGCTGCTCTCAATGCAAATGTGGCGCTCTCTGT
GGCTGGCGGCCCTATTCTGCGGATTAGCCCAGGCCAAAGGTTCCCACAAG
GTGCACTGTTCGGAGGATCAGATGAGGGTTGACATCGGACTGCCGGATGC
GGAGTCAAAGGATCAGAGTGCTCCTCAGATCTATTTGGAGGGATTGAAGG
GATATCCGGATGAACGATGCCAGCCGCAAATCGATGGATCCCTGGCCGTT
TTTCGGCTTTCACTCAGCGATTTTTACGAGTGCGGAGTAACTCGAATGGT
CAACCAGCTAACGGGCAAGAAGGTGTATTACCATAAAATCATCATCGAGT
CAACCAGCGGCAAGGAGATCGTCAGCGTTAAGTGCATCACCACCGCCAGT
CCCGCCTATAATGTGATGATGAATGCCACCACCGGGTCCAGTTCCACGTC
CACTTCCAGCGGCGGCATCCACGGCCTGGTCAAGCGGGATGTGCTGCCGG
CGGGATTCCAGGAACCCGAGGATCTGGAGATCACCACATCGCTGACCAAG
CGGGCCCCGGAGCCACGACTCTCAATTGGCGTTAGCCAGGATGGTCAGAA
GTTCACCAGGGATTTGACTGTCAAGTCGGGCACACCTTTGACAATGGAAA
TCAATCTGGATGAGGACTCTGCACCTGTTTATGGTCTGGGTGTCAACTAT
TTGGATGTGACGGATACGCATACGTCATCGGAAACGTTGATCTTCAAGGG
CTGCACAGTGGATCCCTATCTCTTCGAGAACTTCAACACCATTGATGGCG
ACATTTTGAGTGCCAAGTTCAAGGCCTTCAAGTTCCCCGACTCGTCGTAC
GTGCAATTCCGTGCCACGGTCAACGTGTGTTTGGACAAGTGCCTCGGCAC
CCAGTGCTCAACAACCAGGGTGGGCTTCGGTCGACGCAAGCGAGAGATCA
GCTCAAC

BO07925.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:13:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG13432-PA 1245 l(2)05510-RA 1..893 17..909 4465 100 Plus
CG13432-PA 1245 l(2)05510-RA 903..939 919..955 185 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 04:05:07
Subject Length Description Subject Range Query Range Score Percent Strand
qsm-RB 1956 CG13432-RB 261..1199 17..955 4650 99.8 Plus
qsm-RA 1817 CG13432-RA 122..1060 17..955 4650 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 04:05:02
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20565277..20565503 314..88 1135 100 Minus
2R 25286936 2R 20565000..20565207 520..313 1040 100 Minus
2R 25286936 2R 20563864..20564069 955..750 940 97.1 Minus
2R 25286936 2R 20564130..20564252 750..628 615 100 Minus
2R 25286936 2R 20564322..20564431 629..520 550 100 Minus
2R 25286936 2R 20581559..20581633 91..17 375 100 Minus
Blast to na_te.dros performed on 2015-02-11 04:05:05 has no hits.

BO07925.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:32:46 Download gff for BO07925.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13432-PA 1..941 17..957 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:20:58 Download gff for BO07925.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13432-PA 1..941 17..957 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-22 20:57:33 Download gff for BO07925.5prime
Subject Subject Range Query Range Percent Splice Strand
qsm-RA 122..1062 17..957 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 06:00:37 Download gff for BO07925.5prime
Subject Subject Range Query Range Percent Splice Strand
qsm-RA 122..1062 17..957 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 06:00:37 Download gff for BO07925.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 20581561..20581633 17..89 100   Minus
2R 20565278..20565501 90..313 100 <- Minus
2R 20565001..20565206 314..519 100 <- Minus
2R 20564323..20564431 520..628 100 <- Minus
2R 20564130..20564251 629..750 100 <- Minus
2R 20563862..20564068 751..957 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-22 20:57:33 Download gff for BO07925.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16469066..16469138 17..89 100   Minus
arm_2R 16452783..16453006 90..313 100 <- Minus
arm_2R 16452506..16452711 314..519 100 <- Minus
arm_2R 16451828..16451936 520..628 100 <- Minus
arm_2R 16451635..16451756 629..750 100 <- Minus
arm_2R 16451367..16451573 751..957 98 <- Minus

BO07925.complete Sequence

1276 bp (1276 high quality bases) assembled on 2005-12-21

GenBank Submission: FJ630990

> BO07925.complete
GAAGTTATCAGTCGACATGCTGCTCTCAATGCAAATGTGGCGCTCTCTGT
GGCTGGCGGCCCTATTCTGCGGATTAGCCCAGGCCAAAGGTTCCCACAAG
GTGCACTGTTCGGAGGATCAGATGAGGGTTGACATCGGACTGCCGGATGC
GGAGTCAAAGGATCAGAGTGCTCCTCAGATCTATTTGGAGGGATTGAAGG
GATATCCGGATGAACGATGCCAGCCGCAAATCGATGGATCCCTGGCCGTT
TTTCGGCTTTCACTCAGCGATTTTTACGAGTGCGGAGTAACTCGAATGGT
CAACCAGCTAACGGGCAAGAAGGTGTATTACCATAAAATCATCATCGAGT
CAACCAGCGGCAAGGAGATCGTCAGCGTTAAGTGCATCACCACCGCCAGT
CCCGCCTATAATGTGATGATGAATGCCACCACCGGGTCCAGTTCCACGTC
CACTTCCAGCGGCGGCATCCACGGCCTGGTCAAGCGGGATGTGCTGCCGG
CGGGATTCCAGGAACCCGAGGATCTGGAGATCACCACATCGCTGACCAAG
CGGGCCCCGGAGCCACGACTCTCAATTGGCGTTAGCCAGGATGGTCAGAA
GTTCACCAGGGATTTGACTGTCAAGTCGGGCACACCTTTGACAATGGAAA
TCAATCTGGATGAGGACTCTGCACCTGTTTATGGTCTGGGTGTCAACTAT
TTGGATGTGACGGATACGCATACGTCATCGGAAACGTTGATCTTCAAGGG
CTGCACAGTGGATCCCTATCTCTTCGAGAACTTCAACACCATTGATGGCG
ACATTTTGAGTGCCAAGTTCAAGGCCTTCAAGTTCCCCGACTCGTCGTAC
GTGCAATTCCGTGCCACGGTCAACGTGTGTTTGGACAAGTGCCTCGGCAC
CCAGTGCTCCAACAACCAGGTGGGCTTCGGTCGACGCAAGCGAGAGATCA
GCTCAGCGAACAAGGTCTACGAGATCTCGCTGGCCATGTTCCTGCAGGTT
CAGGATATCGAGGGTGTCAACAAGAATGAGGTCCTGCAGCTGGAGGAGAA
GCTTAGGGAGCTGAAGCTGGCCAACCAGCGCTTGGCCAGGAATAGTCGCG
GCAACTTTGCCATGGAGCAGACGCCCGCCAGTGCTCAGCCCGCCTTTGTC
GTGGACGAGCGGGAGCTGGGACATCTCAGTGCCGGATCGGGAGCCGCATC
GAACGGCCTGTCGCTGGCTCTCTGGACGATTCTGGGGGCATGGAGTTGGC
GGCTGATGGCAAGCTTTCTAGACCAT

BO07925.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:34:36
Subject Length Description Subject Range Query Range Score Percent Strand
qsm-RB 1245 CG13432-PB 1..1242 17..1258 6210 100 Plus
qsm-RA 1245 CG13432-PA 1..1242 17..1258 6210 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:34:37
Subject Length Description Subject Range Query Range Score Percent Strand
qsm-RB 1956 CG13432-RB 261..1502 17..1258 6210 100 Plus
qsm-RA 1817 CG13432-RA 122..1363 17..1258 6210 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:34:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20563789..20564069 1030..750 1390 99.6 Minus
2R 25286936 2R 20563488..20563720 1258..1026 1165 100 Minus
2R 25286936 2R 20565277..20565503 314..88 1135 100 Minus
2R 25286936 2R 20565000..20565207 520..313 1040 100 Minus
2R 25286936 2R 20564130..20564252 750..628 615 100 Minus
2R 25286936 2R 20564322..20564431 629..520 550 100 Minus
2R 25286936 2R 20581559..20581633 91..17 375 100 Minus
Blast to na_te.dros performed on 2014-11-28 08:34:35 has no hits.

BO07925.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:19:00 Download gff for BO07925.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)05510-RA 1..1245 17..1259 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:57:05 Download gff for BO07925.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)05510-RA 118..1359 17..1260 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:22:59 Download gff for BO07925.complete
Subject Subject Range Query Range Percent Splice Strand
qsm-RA 122..1363 17..1260 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:19:00 Download gff for BO07925.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)05510-RA 118..1367 17..1266 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:20:49 Download gff for BO07925.complete
Subject Subject Range Query Range Percent Splice Strand
qsm-RA 122..1363 17..1260 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:20:49 Download gff for BO07925.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20581561..20581633 17..89 100   Minus
2R 20565278..20565501 90..313 100 <- Minus
2R 20565001..20565206 314..519 100 <- Minus
2R 20564323..20564431 520..628 100 <- Minus
2R 20564130..20564251 629..750 100 <- Minus
2R 20563794..20564068 751..1025 100 <- Minus
2R 20563486..20563720 1026..1260 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:22:59 Download gff for BO07925.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16469066..16469138 17..89 100   Minus
arm_2R 16452783..16453006 90..313 100 <- Minus
arm_2R 16452506..16452711 314..519 100 <- Minus
arm_2R 16451828..16451936 520..628 100 <- Minus
arm_2R 16451635..16451756 629..750 100 <- Minus
arm_2R 16451299..16451573 751..1025 100 <- Minus
arm_2R 16450991..16451225 1026..1260 99 <- Minus

BO07925.pep Sequence

Translation from 16 to 1276

> BO07925.pep
MLLSMQMWRSLWLAALFCGLAQAKGSHKVHCSEDQMRVDIGLPDAESKDQ
SAPQIYLEGLKGYPDERCQPQIDGSLAVFRLSLSDFYECGVTRMVNQLTG
KKVYYHKIIIESTSGKEIVSVKCITTASPAYNVMMNATTGSSSTSTSSGG
IHGLVKRDVLPAGFQEPEDLEITTSLTKRAPEPRLSIGVSQDGQKFTRDL
TVKSGTPLTMEINLDEDSAPVYGLGVNYLDVTDTHTSSETLIFKGCTVDP
YLFENFNTIDGDILSAKFKAFKFPDSSYVQFRATVNVCLDKCLGTQCSNN
QVGFGRRKREISSANKVYEISLAMFLQVQDIEGVNKNEVLQLEEKLRELK
LANQRLARNSRGNFAMEQTPASAQPAFVVDERELGHLSAGSGAASNGLSL
ALWTILGAWSWRLMASFLDH

BO07925.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:42:53
Subject Length Description Subject Range Query Range Score Percent Strand
qsm-PB 414 CG13432-PB 1..414 1..414 2134 100 Plus
qsm-PA 414 CG13432-PA 1..414 1..414 2134 100 Plus
nompA-PF 1306 CG13207-PF 810..1053 74..344 171 25.4 Plus
nompA-PD 1549 CG13207-PD 1061..1304 74..344 171 25.4 Plus
nompA-PC 1549 CG13207-PC 1061..1304 74..344 171 25.4 Plus